Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242308 1142 bp mRNA linear INV 02-SEP-2023 (LOC106080775), mRNA. ACCESSION XM_013242308 VERSION XM_013242308.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242308.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1142 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1142 /gene="LOC106080775" /note="glutathione S-transferase theta-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106080775" CDS 198..908 /gene="LOC106080775" /codon_start=1 /product="glutathione S-transferase theta-1" /protein_id="XP_013097762.1" /db_xref="GeneID:106080775" /translation="MPMQPIKFYYDVLNQSSRALYIFLEASKIPFEAVPISLLKGEHL TGEYRDKVTRFKKVPAISDHGFQLSESVAIFRHLAREKLVPEHWYPRKNLGRSRVDEY LEWRQRNMGVACTDYFQQKWLVPYLQKTKPNERSVDVAEKQLERTLNDFENLFLSSKR FMIGDNISYADLMAICEIDQPKYIGYNTFASRNKLTRWYDAVREELGPYYKQVSSEFE NKLRKAEKGHKEAISLKQ" misc_feature 213..440 /gene="LOC106080775" /note="GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with...; Region: GST_N_Theta; cd03050" /db_xref="CDD:239348" misc_feature order(231..236,240..242,249..254,258..266,273..275, 315..317) /gene="LOC106080775" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature order(237..242,324..329,366..371,405..410) /gene="LOC106080775" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239348" misc_feature 240..242 /gene="LOC106080775" /note="sulfate binding site [active]" /db_xref="CDD:239348" misc_feature order(357..359,393..398,402..407,414..416) /gene="LOC106080775" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature 483..860 /gene="LOC106080775" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(486..491,498..500,507..512) /gene="LOC106080775" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(516..518,528..533,540..545,549..554,564..566, 726..728,735..737) /gene="LOC106080775" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" misc_feature order(711..713,723..728,735..737,831..836,846..851) /gene="LOC106080775" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198292" polyA_site 1142 /gene="LOC106080775" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caggccccca atttttcgaa ctcatattaa tcgatcttca ctggtgaatc gagctcagtt 61 cagctttgac tgtggccggt gaaacatcag accaagtgtt tatttacgtg cgcagataaa 121 caacaaaatt tgtttaattt aacgctattg tgtgttcttg tttgatttga aataccttaa 181 aagaaaagaa actaatcatg ccaatgcaac caataaaatt ttattacgat gttctaaatc 241 aatccagtcg tgccttgtat atatttttgg aagcatcgaa aattcccttt gaagctgttc 301 caatatcatt attaaaaggt gagcatttga ctggcgagta tcgagataaa gtaacgcgtt 361 tcaagaaagt tcctgctata agtgatcatg gctttcaact ttcggaaagt gtggctattt 421 tccgtcactt ggcccgcgaa aagcttgtac ccgagcattg gtatccacgt aaaaacttgg 481 gacgcagtcg agtcgatgag tatttggaat ggcgtcagcg taatatgggc gtggcttgca 541 ccgattattt ccagcagaaa tggcttgtgc cgtacctgca gaagacaaaa ccaaacgaga 601 gatccgtaga tgtagctgaa aaacaacttg agcgaaccct aaacgacttc gaaaatctct 661 tcttgagttc gaagaggttt atgattggag acaacatttc atatgcggac ttaatggcca 721 tttgtgagat cgatcagccc aaatatatcg gctacaacac ctttgccagc cgcaataaac 781 tcacaagatg gtacgacgct gtgcgcgaag aattgggtcc atactacaaa caagtttcct 841 ctgaattcga gaacaagttg cgaaaagctg agaaaggcca taaagaagcc atctcgttga 901 agcagtaacg cccctttact ccttatttag cacttagaat atgttgtttg ttttgtttca 961 ttcgataaac ttagatttaa gaacatttcg cacatattgt gagatgatgg tagcttataa 1021 ctttagagtg tatatatgta aaaatatgta tacaagtatg tagtcatttt agtttaatca 1081 aaatatatat gatttcgttc tttgtacatt atagtcatat aataaagtat ttcaaaactt 1141 ca