Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glutathione S-transferase theta-1


LOCUS       XM_013242308            1142 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080775), mRNA.
ACCESSION   XM_013242308
VERSION     XM_013242308.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242308.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1142
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1142
                     /gene="LOC106080775"
                     /note="glutathione S-transferase theta-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106080775"
     CDS             198..908
                     /gene="LOC106080775"
                     /codon_start=1
                     /product="glutathione S-transferase theta-1"
                     /protein_id="XP_013097762.1"
                     /db_xref="GeneID:106080775"
                     /translation="MPMQPIKFYYDVLNQSSRALYIFLEASKIPFEAVPISLLKGEHL
                     TGEYRDKVTRFKKVPAISDHGFQLSESVAIFRHLAREKLVPEHWYPRKNLGRSRVDEY
                     LEWRQRNMGVACTDYFQQKWLVPYLQKTKPNERSVDVAEKQLERTLNDFENLFLSSKR
                     FMIGDNISYADLMAICEIDQPKYIGYNTFASRNKLTRWYDAVREELGPYYKQVSSEFE
                     NKLRKAEKGHKEAISLKQ"
     misc_feature    213..440
                     /gene="LOC106080775"
                     /note="GST_N family, Class Theta subfamily; composed of
                     eukaryotic class Theta GSTs and bacterial dichloromethane
                     (DCM) dehalogenase. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with...; Region:
                     GST_N_Theta; cd03050"
                     /db_xref="CDD:239348"
     misc_feature    order(231..236,240..242,249..254,258..266,273..275,
                     315..317)
                     /gene="LOC106080775"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239348"
     misc_feature    order(237..242,324..329,366..371,405..410)
                     /gene="LOC106080775"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239348"
     misc_feature    240..242
                     /gene="LOC106080775"
                     /note="sulfate binding site [active]"
                     /db_xref="CDD:239348"
     misc_feature    order(357..359,393..398,402..407,414..416)
                     /gene="LOC106080775"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239348"
     misc_feature    483..860
                     /gene="LOC106080775"
                     /note="C-terminal, alpha helical domain of Class Theta
                     Glutathione S-transferases; Region: GST_C_Theta; cd03183"
                     /db_xref="CDD:198292"
     misc_feature    order(486..491,498..500,507..512)
                     /gene="LOC106080775"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(516..518,528..533,540..545,549..554,564..566,
                     726..728,735..737)
                     /gene="LOC106080775"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(711..713,723..728,735..737,831..836,846..851)
                     /gene="LOC106080775"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198292"
     polyA_site      1142
                     /gene="LOC106080775"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caggccccca atttttcgaa ctcatattaa tcgatcttca ctggtgaatc gagctcagtt
       61 cagctttgac tgtggccggt gaaacatcag accaagtgtt tatttacgtg cgcagataaa
      121 caacaaaatt tgtttaattt aacgctattg tgtgttcttg tttgatttga aataccttaa
      181 aagaaaagaa actaatcatg ccaatgcaac caataaaatt ttattacgat gttctaaatc
      241 aatccagtcg tgccttgtat atatttttgg aagcatcgaa aattcccttt gaagctgttc
      301 caatatcatt attaaaaggt gagcatttga ctggcgagta tcgagataaa gtaacgcgtt
      361 tcaagaaagt tcctgctata agtgatcatg gctttcaact ttcggaaagt gtggctattt
      421 tccgtcactt ggcccgcgaa aagcttgtac ccgagcattg gtatccacgt aaaaacttgg
      481 gacgcagtcg agtcgatgag tatttggaat ggcgtcagcg taatatgggc gtggcttgca
      541 ccgattattt ccagcagaaa tggcttgtgc cgtacctgca gaagacaaaa ccaaacgaga
      601 gatccgtaga tgtagctgaa aaacaacttg agcgaaccct aaacgacttc gaaaatctct
      661 tcttgagttc gaagaggttt atgattggag acaacatttc atatgcggac ttaatggcca
      721 tttgtgagat cgatcagccc aaatatatcg gctacaacac ctttgccagc cgcaataaac
      781 tcacaagatg gtacgacgct gtgcgcgaag aattgggtcc atactacaaa caagtttcct
      841 ctgaattcga gaacaagttg cgaaaagctg agaaaggcca taaagaagcc atctcgttga
      901 agcagtaacg cccctttact ccttatttag cacttagaat atgttgtttg ttttgtttca
      961 ttcgataaac ttagatttaa gaacatttcg cacatattgt gagatgatgg tagcttataa
     1021 ctttagagtg tatatatgta aaaatatgta tacaagtatg tagtcatttt agtttaatca
     1081 aaatatatat gatttcgttc tttgtacatt atagtcatat aataaagtat ttcaaaactt
     1141 ca