Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mediator of RNA polymerase II


LOCUS       XM_013242283             870 bp    mRNA    linear   INV 02-SEP-2023
            transcription subunit 18 (LOC106080758), mRNA.
ACCESSION   XM_013242283
VERSION     XM_013242283.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242283.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..870
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..870
                     /gene="LOC106080758"
                     /note="mediator of RNA polymerase II transcription subunit
                     18; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106080758"
     CDS             64..711
                     /gene="LOC106080758"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 18"
                     /protein_id="XP_013097737.1"
                     /db_xref="GeneID:106080758"
                     /translation="MAQVASSKESLSQALHNKIVPNQEYLLQGSIIASAVDHLIHRLR
                     GLCDNVENVPETFHDLEVCMSMRQPNQHVPLQVRVRRALDRDVPFQLRYIGQPELDRS
                     RPTLVRSSIDVGCTSTVLEFLNELGCRIDFEYVSQGFLFRKGRMKITVAKILKIVPGK
                     QHDSEPVCNSYLVELSVLAPTGQDAIGDEMRIFAEQLKPLVHLEKIDCKRLGNIP"
     misc_feature    130..684
                     /gene="LOC106080758"
                     /note="Med18 protein; Region: Med18; pfam09637"
                     /db_xref="CDD:462845"
     polyA_site      870
                     /gene="LOC106080758"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattgataat tttgcccctg tgcaaacaaa tgcatacatt tttaataaca ttaacaataa
       61 accatggctc aggttgcatc ttcaaaggaa tccttgtcac aggctctgca taataaaatt
      121 gttccaaacc aggagtatct attacaaggt tcaattattg catctgctgt tgaccactta
      181 attcacaggc ttcgtggttt atgcgataat gtggaaaatg ttccagaaac atttcatgat
      241 ttggaagtgt gcatgagcat gaggcagccc aatcagcatg tgccgttgca agttcgtgtt
      301 cgacgtgcgc tggaccggga cgttccattt cagttacgat acattggaca accggaatta
      361 gatcggtcta ggccgacttt agtgcggtca agtattgatg tggggtgtac gtctactgtt
      421 ctggagttct taaatgagct aggatgtcgc attgattttg agtacgttag ccaaggtttc
      481 ctgtttagaa aaggtcgaat gaagataacc gttgcaaaga ttctcaaaat agttcccgga
      541 aagcagcatg acagtgagcc agtatgtaat agttatttag ttgagttatc ggttctggct
      601 cccactggtc aggatgccat tggagacgaa atgcgtatct ttgccgaaca gttgaagcca
      661 ttggtgcatc tggaaaaaat agattgcaaa aggctaggca atattccata gaactcatct
      721 ctttaaagca ttgtctacat cttctttaga acccataaat agtcaagtta aaaatattta
      781 tacatataaa aagagcatat acttgaaaag ttttagattt taaatatata tacgaggatc
      841 atcatgttca actgggtctg acctacctaa