Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242283 870 bp mRNA linear INV 02-SEP-2023 transcription subunit 18 (LOC106080758), mRNA. ACCESSION XM_013242283 VERSION XM_013242283.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242283.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..870 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..870 /gene="LOC106080758" /note="mediator of RNA polymerase II transcription subunit 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106080758" CDS 64..711 /gene="LOC106080758" /codon_start=1 /product="mediator of RNA polymerase II transcription subunit 18" /protein_id="XP_013097737.1" /db_xref="GeneID:106080758" /translation="MAQVASSKESLSQALHNKIVPNQEYLLQGSIIASAVDHLIHRLR GLCDNVENVPETFHDLEVCMSMRQPNQHVPLQVRVRRALDRDVPFQLRYIGQPELDRS RPTLVRSSIDVGCTSTVLEFLNELGCRIDFEYVSQGFLFRKGRMKITVAKILKIVPGK QHDSEPVCNSYLVELSVLAPTGQDAIGDEMRIFAEQLKPLVHLEKIDCKRLGNIP" misc_feature 130..684 /gene="LOC106080758" /note="Med18 protein; Region: Med18; pfam09637" /db_xref="CDD:462845" polyA_site 870 /gene="LOC106080758" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattgataat tttgcccctg tgcaaacaaa tgcatacatt tttaataaca ttaacaataa 61 accatggctc aggttgcatc ttcaaaggaa tccttgtcac aggctctgca taataaaatt 121 gttccaaacc aggagtatct attacaaggt tcaattattg catctgctgt tgaccactta 181 attcacaggc ttcgtggttt atgcgataat gtggaaaatg ttccagaaac atttcatgat 241 ttggaagtgt gcatgagcat gaggcagccc aatcagcatg tgccgttgca agttcgtgtt 301 cgacgtgcgc tggaccggga cgttccattt cagttacgat acattggaca accggaatta 361 gatcggtcta ggccgacttt agtgcggtca agtattgatg tggggtgtac gtctactgtt 421 ctggagttct taaatgagct aggatgtcgc attgattttg agtacgttag ccaaggtttc 481 ctgtttagaa aaggtcgaat gaagataacc gttgcaaaga ttctcaaaat agttcccgga 541 aagcagcatg acagtgagcc agtatgtaat agttatttag ttgagttatc ggttctggct 601 cccactggtc aggatgccat tggagacgaa atgcgtatct ttgccgaaca gttgaagcca 661 ttggtgcatc tggaaaaaat agattgcaaa aggctaggca atattccata gaactcatct 721 ctttaaagca ttgtctacat cttctttaga acccataaat agtcaagtta aaaatattta 781 tacatataaa aagagcatat acttgaaaag ttttagattt taaatatata tacgaggatc 841 atcatgttca actgggtctg acctacctaa