Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster neuroglian, transcript variant C (Nrg),


LOCUS       NM_206657               5090 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_206657
VERSION     NM_206657.4
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 5090)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5090)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 5090)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 5090)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 5090)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 5090)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 5090)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 5090)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 5090)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 5090)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 5090)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 5090)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 5090)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 5090)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 5090)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 5090)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 5090)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 5090)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 16, 2013 this sequence version replaced NM_206657.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5090
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..5090
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Neuroglian"
                     /map="7F2-7F4"
                     /db_xref="FLYBASE:FBgn0264975"
                     /db_xref="GeneID:31792"
     CDS             299..4018
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="CG1634 gene product from transcript CG1634-RC;
                     CG1634-PC; Nrg-PC; icebox; central brain deranged;
                     neuroglian; lethal (1) G0488; female sterile(1)M72"
                     /codon_start=1
                     /product="neuroglian, isoform C"
                     /protein_id="NP_996380.1"
                     /db_xref="FLYBASE:FBpp0089326"
                     /db_xref="GeneID:31792"
                     /db_xref="FLYBASE:FBgn0264975"
                     /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV
                     AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK
                     DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG
                     FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF
                     RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP
                     QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN
                     VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD
                     NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT
                     IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE
                     IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE
                     AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT
                     CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA
                     NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI
                     EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE
                     SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT
                     WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE
                     GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI
                     TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE
                     QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP
                     ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII
                     LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK
                     PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL"
     misc_feature    383..682
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    461..475
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    500..514
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    578..592
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    620..637
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    662..673
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    707..946
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    749..763
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    791..805
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    872..886
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    923..940
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1049..1294
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: ig; pfam00047"
                     /db_xref="CDD:395002"
     misc_feature    1088..1102
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1127..1141
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1211..1225
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1238..1255
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1280..1291
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1313..1579
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fourth immunoglobulin (Ig)-like domain of hemolin,
                     and similar domains; a member of the I-set of IgSF
                     domains; Region: IgI_4_hemolin-like; cd20978"
                     /db_xref="CDD:409570"
     misc_feature    1313..1324
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409570"
     misc_feature    1340..1351
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409570"
     misc_feature    1364..1387
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    1403..1420
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1427..1435
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409570"
     misc_feature    1457..1471
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409570"
     misc_feature    1475..1489
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1514..1540
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1547..1579
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    1634..1849
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1643..1657
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1682..1696
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1745..1759
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1787..1804
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1826..1837
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1859..2143
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1910..1924
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1955..1969
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2027..2041
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2069..2086
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2108..2119
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2135..2419
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    2345..>3451
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2384..2389,2393..2398)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3047..3049,3257..3259,3302..3304)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3050..3319
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3419..3631
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(3608..3613,3617..3622)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    3761..4009
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Bravo-like intracellular region; Region:
                     Bravo_FIGEY; pfam13882"
                     /db_xref="CDD:464016"
ORIGIN      
        1 gcagttcctc tccgcattcg aaaagaaaat atccgcgctg ctggttgttg caacagcaga
       61 aagtaataaa agctcggctc gcatgcaatt ttcattagtg ggaaaattgt ttgatattta
      121 agaggcaacc gaggaataaa cggaatcaac agcagcagac acacacacac acattccaag
      181 ccaaattaat aatagaaaag aaaaacaaaa aaaaaaaaac agcaaccaga aaaccaataa
      241 aagtttaaac caaaacgaaa cacactcgag ggggcgagcg gagagccaaa cgaccaaaat
      301 gtggcggcag tcaacgatac tggccgcgtt actagtggct cttttgtgtg cgggcagtgc
      361 agaaagcaaa ggcaatcgcc caccaagaat caccaaacaa ccggcacccg gagaattgct
      421 cttcaaagtg gcgcaacaga ataaggaaag tgacaatcca ttcataatcg agtgcgaagc
      481 cgatggacaa cccgagccag aatatagttg gatcaagaac ggcaagaagt tcgattggca
      541 ggcgtacgat aaccgcatgc tgcggcagcc aggacgtggc accctggtga tcaccatacc
      601 caaggacgag gatcgcggcc actatcagtg ctttgcgtcc aatgaattcg gaacggccac
      661 ctcgaactca gtatatgtgc gtaaggccga gctgaatgcc ttcaaggatg aggcggccaa
      721 gacactggag gccgtcgagg gtgagccctt tatgctgaaa tgtgccgcac ccgatggttt
      781 tcccagtccg acagtcaact ggatgatcca ggagtccatc gatggcagca tcaagtcgat
      841 caacaactct cgcatgaccc tcgatcctga gggtaatctc tggttctcga atgttacccg
      901 tgaggatgcc agctccgatt tctactatgc ctgctcggcc acctcggtgt ttcgcagtga
      961 atacaagatt ggcaacaagg tgctcctcga tgtcaaacag atgggcgtta gtgcctcgca
     1021 gaacaagcat ccgcccgtgc gtcaatatgt ttcccgtcgc cagtccttgg cgttgcgtgg
     1081 caagcgaatg gaactgtttt gcatctacgg tggaacaccg ctgccgcaga ccgtgtggag
     1141 caaggatggc cagcgtatac agtggagcga tcgaataacg caaggacact atggcaaatc
     1201 actggtcatt cggcagacaa atttcgatga tgccggcaca tacacctgcg acgtgtccaa
     1261 cggtgtgggc aatgcccaat ccttctccat cattctgaat gttaactccg tgccgtactt
     1321 taccaaagaa cctgaaatcg ccaccgccgc cgaagacgaa gaggttgtct tcgagtgtcg
     1381 cgctgctggt gtaccagagc ccaagatcag ttggattcac aatggtaagc ccatcgagca
     1441 gagcaccccg aatccccgac gaacggttac ggacaacaca attcgcatta tcaatctggt
     1501 taagggcgat actggtaact acggttgcaa cgccaccaat tcgctgggat atgtgtataa
     1561 ggatgtctat ctaaatgtcc aggctgagcc gccaacgatt tccgaagctc cagcagctgt
     1621 atccactgtc gatggaagga atgtgaccat taagtgcagg gttaacggtt cccccaagcc
     1681 tctggttaaa tggctaaggg ccagcaactg gctgaccgga ggtcgttaca atgtccaagc
     1741 taacggtgac ctggagatcc aagatgtgac attctcggat gccggcaaat acacatgcta
     1801 tgcgcagaac aagtttggtg aaattcaagc cgatggttcg ctggtggtca aggagcatac
     1861 gagaattacc caagagccgc aaaactacga ggtggccgcc ggacaatcgg ccacgttccg
     1921 ctgtaacgag gcccacgacg atacgctgga gattgagatc gattggtgga aggatggcca
     1981 gtccattgac tttgaggccc agccgcgatt cgtgaagacc aatgataatt ccctgacgat
     2041 tgccaagaca atggagttgg attctggcga atatacgtgc gtggcccgga cgcgtttgga
     2101 tgaggcaacg gccagggcga atttgattgt ccaggatgtg ccgaatgcac caaaactgac
     2161 cggcatcacc tgccaggccg acaaggccga gatccactgg gaacagcagg gtgacaatcg
     2221 ttcgcccatt ctgcactaca ccattcagtt caatacatcg ttcacgcccg cctcctggga
     2281 tgccgcctac gagaaggtgc ccaacacgga ctcctcgttc gtcgtccaga tgtcaccgtg
     2341 ggccaactat acgttccgtg tgattgcctt caacaagatc ggagcctcgc cgccgtcggc
     2401 gcacagcgat agctgcacca cccagccgga tgtgcccttc aagaatcccg acaatgtcgt
     2461 tggccagggc actgagccca acaatctggt catctcgtgg actcccatgc ccgaaatcga
     2521 gcacaatgcc cccaatttcc attattatgt tagctggaaa cgcgatattc ctgccgctgc
     2581 gtgggaaaac aataacatat tcgactggcg acagaacaac attgtgattg ccgatcaacc
     2641 gactttcgtg aaatacctga tcaaggtggt ggccatcaac gataggggtg agtccaatgt
     2701 ggccgccgag gaggtggttg gctactctgg cgaagatcgt cccctggatg cgcccaccaa
     2761 cttcacaatg aggcaaatca catcatcgac cagtggctac atggcctgga cgccggtaag
     2821 tgaggaatcg gtgcgcggac acttcaaggg ctacaaaatc caaacgtgga cggagaacga
     2881 gggcgaggag ggtctgcggg agatccatgt gaagggtgat acccacaacg ctctggtcac
     2941 acaattcaag cccgattcaa agaactatgc ccgcattttg gcttacaatg gacgcttcaa
     3001 tggcccaccc agtgccgtca tcgacttcga tactccggag ggtgtaccat cgccggttca
     3061 gggactggat gcctatcctc tgggctcctc ggccttcatg ctccactgga agaagccgct
     3121 gtatcccaat ggcaagctca ctggctacaa gatctactac gaggaggtta aggagagcta
     3181 tgtgggcgag cgacgcgaat acgatccaca catcaccgat cccagggtca cacgcatgaa
     3241 gatggccggc ctgaagccca actccaagta ccgcatctcc atcactgcca ccacgaaaat
     3301 gggcgaggga tctgaacact atatcgaaaa gaccacgctc aaggatgccg tcaatgtggc
     3361 ccctgccacg ccatctttct cctgggagca actgccatcc gacaatggac tagccaagtt
     3421 ccgcatcaac tggctgccaa gtaccgaggg tcatccaggc actcacttct ttacgatgca
     3481 caggatcaag ggcgaaaccc aatggatacg cgagaatgag gaaaagaact ccgattacca
     3541 ggaggtcggt ggcttagatc cggagaccgc ctacgagttc cgcgtggtgt ccgtggatgg
     3601 ccactttaac acggagagtg ccacgcagga gatcgacacg aacaccgttg agggaccaat
     3661 aatggtggcc aacgagacgg tggccaatgc cggatggttc attggcatga tgctggccct
     3721 ggccttcatc atcatcctct tcatcatcat ctgcattatc cgacgcaatc ggggcggaaa
     3781 gtacgatgtc cacgatcggg agctggccaa cggccggcgg gattatcccg aagagggcgg
     3841 attccacgag tactcgcaac cgttggataa caagagcgct ggtcgccaat ccgtgagttc
     3901 agcgaacaaa ccgggcgtgg aaagcgatac tgattcgatg gccgaatacg gtgatggcga
     3961 tacaggcatg aatgaagatg gatcctttat tggccaatat ggacgcaaag gactttgatt
     4021 taattagtaa gcagcgcacc gcaacagcaa ctcaaaaata atatcgaaac cgagccctta
     4081 accccaaaaa tcaaaaaatc aacaagacca aacaccatca cagcagaaaa atgaaaaaat
     4141 taatgaaaat aatagtagcc tacattttat tcgactataa gtgcaaacac cacgactaat
     4201 ttaaagtata tataaaaata gaggttttat atataactat taaaatctta aaatgtgtaa
     4261 aaaaaaaaac aaacaaacaa aatgaatgca aatcaatact gccaaacaac ttgaacaaca
     4321 agcaacacaa cagcaaaaac aacaacaacg agaatgcagc aaaaaggcta ttatcaaaat
     4381 aaaagtcttc atatcggaag aagtagttat cgaaaaagaa atgcatgcga atcaaaccga
     4441 attatgaaaa aaaaaatcat ataattttct ggacgttatg gggatgatgc gtgtaatttt
     4501 tttttatttt aaagaaattt aagaaactat gtatgaggaa aataatgaag ctcgcttatg
     4561 aaatctctat attgcgcaca tgtctacctg tcccactctg tccccggtac tctgtatatc
     4621 tttgtcccgc tctctccctt ctctacttgt aatgcatata tatttataaa tataaagcgt
     4681 aaataagtta taatttagta atttttttat aaagcaacag cacttgaatg tcaaatctcc
     4741 gttttagatt ggtcgtaaat cgaaatgaaa ctctctttta gcttacatgt ttactacttt
     4801 atttaagcct attgtgtgta ttttgttttt atttcattat tttatttttt ttagttcgtg
     4861 taatgacttt gaattttttt gctttgaaat tgaaacaatg ttttagtata gcctcgtgtt
     4921 tgttttccgg gaagagcaac aaaaatgaag tgtatttttt cagtgtattt aatattaaag
     4981 aatgaatgac gaaaacatca taattatatg aaaatataat tttttttaca tatgttgatg
     5041 tacgttcgca tataaattta gaaagaaaac aaataaaata aagaaaaccg