Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster neuropilin and tolloid-like, transcript


LOCUS       NM_167371               3362 bp    mRNA    linear   INV 26-DEC-2023
            variant A (Neto), mRNA.
ACCESSION   NM_167371
VERSION     NM_167371.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 3362)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3362)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3362)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 3362)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 3362)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 3362)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 3362)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 3362)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 3362)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 3362)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 3362)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 3362)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 3362)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 3362)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 3362)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 3362)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 3362)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 3362)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_167371.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3362
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..3362
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /old_locus_tag="Dmel_CG15753"
                     /old_locus_tag="Dmel_CG32635"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="Neuropilin and tolloid-like"
                     /map="11F7-12A2"
                     /db_xref="FLYBASE:FBgn0265416"
                     /db_xref="GeneID:32303"
     CDS             597..2630
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /old_locus_tag="Dmel_CG15753"
                     /old_locus_tag="Dmel_CG32635"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="CG44328 gene product from transcript CG44328-RA;
                     CG44328-PA; Neto-PA; neuropilin and tolloid-like"
                     /codon_start=1
                     /product="neuropilin and tolloid-like, isoform A"
                     /protein_id="NP_727708.1"
                     /db_xref="FLYBASE:FBpp0308759"
                     /db_xref="GeneID:32303"
                     /db_xref="FLYBASE:FBgn0265416"
                     /translation="MRRRGSTCSAQQPQQRPHKQQQQQQQQNQRLIPGQRCSLLMLLI
                     VGQAVYASAGSEIIANRSASAGESLIMLSNFTVATPPPAPRFTSPFREQDVAEGEELA
                     GGGQVDWLDEQHPLTISRPPRAGRSERQAEEDQVDRCRLFVEGDPTKNELYSPEYPNL
                     YPKNINCTRVITAPKGQIIRLDFRNSFNIEAKEGCKFDFLEIRDGQYGFSTLIGKFCG
                     TDFPPEITSKERYLWLHFHSDETIEYTGFSAVYEYLDRSRDAPSTDLNCTIDKGGFEG
                     FINSTDVPAEIWEQVNRNKIALDCIWRIQVKENWKIFLKFLDFKLSKPNDCQTNFLDI
                     FPEQTVMPLRVKNFCGSAGESITAESNILHLRFYADQTAINSTFGILFTAFRERGAAC
                     TEDEYDCEDATCISKDLKCNNLDNCKFRWDEEGCTSEAAGQSEHVVIIVIVFGLILGG
                     MVITFIVNCIRKIIRDQKIIRDVPALSDGIYHIDSFILEAPKSAIFVGLQNDFMCDFS
                     YSSDGQMAPNLGHETRDEEAAVGGDSDFDSQMDSPKQTCDCDFELDVNDGEQMEEDDE
                     EELEEEQEQDHHVEDQEYDDGIGFSCDSDSGLTLPEDDDEFVLVTGQCLPSNSSHSCS
                     SSMQCSSGSSGREVATSSSNSMELDMVLTPPPPPTLGKPKSGVHPLKFLHKII"
     misc_feature    1047..1352
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /old_locus_tag="Dmel_CG15753"
                     /old_locus_tag="Dmel_CG32635"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(1047..1049,1053..1055,1134..1136,1152..1154,
                     1266..1268,1338..1340,1344..1346,1350..1352)
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    <1488..1748
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /old_locus_tag="Dmel_CG15753"
                     /old_locus_tag="Dmel_CG32635"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    1770..1874
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /old_locus_tag="Dmel_CG15753"
                     /old_locus_tag="Dmel_CG32635"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1785..1787,1809..1811,1842..1847)
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1821..1823,1830..1832,1842..1844,1860..1865)
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1851..1865
                     /gene="Neto"
                     /locus_tag="Dmel_CG44328"
                     /gene_synonym="CG12727; CG15751; CG15752; CG15753;
                     CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO;
                     tld-like"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
ORIGIN      
        1 cccagtctac gtcgagttgg ccacgtgtac ggacacgcgg cgcggttcgc tttctccggt
       61 gacagcacat tcgatattaa cgtttcacta ccaaaaaaaa aaaaacatcg cgattggttg
      121 ctaatagaca agcaccagag atacgatttt aaaatcttaa ggttttgctt ttgttcaaaa
      181 gaaatacaaa tttttttgtt tggttgtttg tgtgacagtg acagtgccag tgtgaaagtg
      241 tgtgtgtgtg aaaagcttgc cggcttgaaa aatgcgcgcc aaaaattgag atattttcgc
      301 ggagcgcagc ggcaacaaaa acaaataaaa acaacatttc gcaacgcagc caaaggaggc
      361 gacaacacgc aaatagacac tctgaagtgt atggtcgttg gaattcgcaa atctaaggac
      421 tggcaaatta aaaactaaat gacgcatgat taacaaacgc tctgctgttc gttgtcggaa
      481 tttttgcgtt acgtgtgagg gactcttact gcgagcggag cagcagaaag agagggtgca
      541 agtaggctag agcgaggcgg agactataag actgaagctg gcaaacctca cacaaaatgc
      601 gaagaagagg aagcacttgc agcgcacaac aaccacagca gcggccacac aaacagcagc
      661 agcagcagca gcagcaaaat caaaggttaa tccccggcca acgctgttcg ctgctaatgt
      721 tgctaattgt tggccaagca gtttacgctt ctgccggcag tgagataatc gcaaatcgtt
      781 cggcttcagc tggcgaatcg ttgataatgc tgtcgaattt caccgttgcc acgccgcctc
      841 ccgccccaag attcaccagt ccctttcggg agcaggatgt ggctgagggg gaggagttgg
      901 cgggtggagg gcaggtcgat tggttggacg agcagcatcc gctgaccatt tcccgaccgc
      961 caagagcagg acgcagcgag cggcaggcag aagaggatca ggtggaccgc tgtcgtctct
     1021 ttgtcgaggg ggatcccacc aagaatgagc tgtacagccc cgagtatccc aacttgtatc
     1081 cgaagaacat caactgcacc cgggtgataa cagcgccaaa gggacaaatc atacgcctgg
     1141 actttcgcaa ctcgtttaat atcgaggcca aggaggggtg caaatttgat tttctcgaaa
     1201 tacgagatgg ccagtacggt ttctctacgc tgattggcaa gttctgcggc accgactttc
     1261 cgccggagat cacctcgaag gagcggtatt tgtggcttca tttccactcc gacgagacca
     1321 tcgagtacac cggattcagt gcggtctatg agtatctgga caggagtcgg gatgcgccca
     1381 gcaccgatct caactgcacc atcgataagg gcggcttcga gggcttcatc aactccacgg
     1441 atgttccggc cgagatctgg gagcaggtca atcgcaataa gatcgcgctg gactgcatct
     1501 ggcgcattca ggtcaaggag aattggaaga tatttctcaa gtttctggac ttcaagctga
     1561 gcaagccgaa cgattgtcaa accaacttcc tggatatatt cccggagcag acggtgatgc
     1621 cactgagggt taagaacttt tgcggttcag ctggcgagag tattacggcg gagtcaaata
     1681 tcctgcactt gcgcttctac gcagatcaaa ccgcgattaa ctcgacattt ggcattctgt
     1741 tcacggcgtt ccgggaacgt ggagctgcct gcaccgagga cgagtacgat tgcgaggacg
     1801 cgacctgcat atcaaaggat ttgaaatgta ataacctaga caattgtaaa tttcgatggg
     1861 acgaggaggg ctgcacgagc gaggcggccg gccaatcgga gcacgtggtc atcatcgtga
     1921 ttgtgtttgg cctgatactc ggcggaatgg tcattacgtt catcgtcaat tgcatacgca
     1981 agataatacg tgatcagaag ataatacgcg acgtgcccgc gttgagtgac ggaatctatc
     2041 acattgattc ctttatactg gaagcgccca agagcgcgat tttcgtggga ttacagaatg
     2101 atttcatgtg cgatttctcc tactcatcgg acgggcaaat ggcgcccaac ttggggcatg
     2161 agacccgaga tgaggaggcc gcagttggtg gcgattccga ctttgattcg cagatggact
     2221 cgccgaagca gacgtgtgac tgtgatttcg agttggatgt gaacgatggc gaacaaatgg
     2281 aggaagacga tgaagaggag ctggaggaag agcaggagca ggaccatcat gtggaggatc
     2341 aggagtacga cgatggcatt ggtttcagtt gtgacagcga cagcggactc acactgcccg
     2401 aggacgatga tgagtttgta ctggtcaccg gacagtgtct gcccagcaac tccagtcact
     2461 cgtgcagcag ttcgatgcaa tgcagcagcg gttctagtgg cagagaggtg gctactagct
     2521 cctcaaactc catggaactg gacatggttc taacaccgcc accgccacca acactgggca
     2581 agcccaagtc cggtgtacat cccctcaagt tcctgcacaa aatcatctag aaaagaaact
     2641 cattcgaaat tcattcgctc acgttctgcg gtggtgaagg tggttcagtg accacctgct
     2701 gctgctgcat gcaaatctgc atcgacatca ttaaaatcag gctggccgaa attgcgcaaa
     2761 aaaaagaaaa aagaaagaga aatgcgatat cgaacccata ccattgtgac ccgaccttcg
     2821 ctttgcccac gtagttcgtg ctgagttcac cgcaaaccag aaatcagaac aaaatcaaat
     2881 ccttgatcct tggggggatt tgcagttcga cgtcattttc ccctcattag ttaagctgct
     2941 aattgtgtgg cgggctatat cctagatata cgccccctta ggtaggaata cagttaacag
     3001 tattatggat ataacctcat taaaaggctt acagtttata gaaagtatta tgcgaaaaat
     3061 gatggcaacc aaggtggatc aaatataaat aaaacgattt atgcattgag tcttggcgca
     3121 attgaataat tttacagagc cctgtgatcc acgtttctta accctaagta gctattgaaa
     3181 ttttaataat ttaatgttct cattggacgg acaatcgtgc aatgcaaagc taagtaaata
     3241 gttaactgtt ggctaaacga atggctgcca aaactaatac cgcacaaggg ctatatacga
     3301 gtatataact atatatatat ataaatatat atataaatga aaaataaata tcttacaaaa
     3361 tt