Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_167371 3362 bp mRNA linear INV 26-DEC-2023 variant A (Neto), mRNA. ACCESSION NM_167371 VERSION NM_167371.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 3362) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 3362) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 3362) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 3362) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 3362) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 3362) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 3362) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 3362) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 3362) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 3362) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 3362) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 3362) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 3362) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 3362) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 3362) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 3362) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 3362) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 3362) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_167371.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3362 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..3362 /gene="Neto" /locus_tag="Dmel_CG44328" /old_locus_tag="Dmel_CG15753" /old_locus_tag="Dmel_CG32635" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="Neuropilin and tolloid-like" /map="11F7-12A2" /db_xref="FLYBASE:FBgn0265416" /db_xref="GeneID:32303" CDS 597..2630 /gene="Neto" /locus_tag="Dmel_CG44328" /old_locus_tag="Dmel_CG15753" /old_locus_tag="Dmel_CG32635" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="CG44328 gene product from transcript CG44328-RA; CG44328-PA; Neto-PA; neuropilin and tolloid-like" /codon_start=1 /product="neuropilin and tolloid-like, isoform A" /protein_id="NP_727708.1" /db_xref="FLYBASE:FBpp0308759" /db_xref="GeneID:32303" /db_xref="FLYBASE:FBgn0265416" /translation="MRRRGSTCSAQQPQQRPHKQQQQQQQQNQRLIPGQRCSLLMLLI VGQAVYASAGSEIIANRSASAGESLIMLSNFTVATPPPAPRFTSPFREQDVAEGEELA GGGQVDWLDEQHPLTISRPPRAGRSERQAEEDQVDRCRLFVEGDPTKNELYSPEYPNL YPKNINCTRVITAPKGQIIRLDFRNSFNIEAKEGCKFDFLEIRDGQYGFSTLIGKFCG TDFPPEITSKERYLWLHFHSDETIEYTGFSAVYEYLDRSRDAPSTDLNCTIDKGGFEG FINSTDVPAEIWEQVNRNKIALDCIWRIQVKENWKIFLKFLDFKLSKPNDCQTNFLDI FPEQTVMPLRVKNFCGSAGESITAESNILHLRFYADQTAINSTFGILFTAFRERGAAC TEDEYDCEDATCISKDLKCNNLDNCKFRWDEEGCTSEAAGQSEHVVIIVIVFGLILGG MVITFIVNCIRKIIRDQKIIRDVPALSDGIYHIDSFILEAPKSAIFVGLQNDFMCDFS YSSDGQMAPNLGHETRDEEAAVGGDSDFDSQMDSPKQTCDCDFELDVNDGEQMEEDDE EELEEEQEQDHHVEDQEYDDGIGFSCDSDSGLTLPEDDDEFVLVTGQCLPSNSSHSCS SSMQCSSGSSGREVATSSSNSMELDMVLTPPPPPTLGKPKSGVHPLKFLHKII" misc_feature 1047..1352 /gene="Neto" /locus_tag="Dmel_CG44328" /old_locus_tag="Dmel_CG15753" /old_locus_tag="Dmel_CG32635" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast; Region: CUB; cd00041" /db_xref="CDD:238001" misc_feature order(1047..1049,1053..1055,1134..1136,1152..1154, 1266..1268,1338..1340,1344..1346,1350..1352) /gene="Neto" /locus_tag="Dmel_CG44328" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="heterodimerization interface [polypeptide binding]; other site" /db_xref="CDD:238001" misc_feature <1488..1748 /gene="Neto" /locus_tag="Dmel_CG44328" /old_locus_tag="Dmel_CG15753" /old_locus_tag="Dmel_CG32635" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast; Region: CUB; cd00041" /db_xref="CDD:238001" misc_feature 1770..1874 /gene="Neto" /locus_tag="Dmel_CG44328" /old_locus_tag="Dmel_CG15753" /old_locus_tag="Dmel_CG32635" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(1785..1787,1809..1811,1842..1847) /gene="Neto" /locus_tag="Dmel_CG44328" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(1821..1823,1830..1832,1842..1844,1860..1865) /gene="Neto" /locus_tag="Dmel_CG44328" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 1851..1865 /gene="Neto" /locus_tag="Dmel_CG44328" /gene_synonym="CG12727; CG15751; CG15752; CG15753; CG32635; CG44328; CT36003; Dmel\CG44328; net; neto; NETO; tld-like" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" ORIGIN 1 cccagtctac gtcgagttgg ccacgtgtac ggacacgcgg cgcggttcgc tttctccggt 61 gacagcacat tcgatattaa cgtttcacta ccaaaaaaaa aaaaacatcg cgattggttg 121 ctaatagaca agcaccagag atacgatttt aaaatcttaa ggttttgctt ttgttcaaaa 181 gaaatacaaa tttttttgtt tggttgtttg tgtgacagtg acagtgccag tgtgaaagtg 241 tgtgtgtgtg aaaagcttgc cggcttgaaa aatgcgcgcc aaaaattgag atattttcgc 301 ggagcgcagc ggcaacaaaa acaaataaaa acaacatttc gcaacgcagc caaaggaggc 361 gacaacacgc aaatagacac tctgaagtgt atggtcgttg gaattcgcaa atctaaggac 421 tggcaaatta aaaactaaat gacgcatgat taacaaacgc tctgctgttc gttgtcggaa 481 tttttgcgtt acgtgtgagg gactcttact gcgagcggag cagcagaaag agagggtgca 541 agtaggctag agcgaggcgg agactataag actgaagctg gcaaacctca cacaaaatgc 601 gaagaagagg aagcacttgc agcgcacaac aaccacagca gcggccacac aaacagcagc 661 agcagcagca gcagcaaaat caaaggttaa tccccggcca acgctgttcg ctgctaatgt 721 tgctaattgt tggccaagca gtttacgctt ctgccggcag tgagataatc gcaaatcgtt 781 cggcttcagc tggcgaatcg ttgataatgc tgtcgaattt caccgttgcc acgccgcctc 841 ccgccccaag attcaccagt ccctttcggg agcaggatgt ggctgagggg gaggagttgg 901 cgggtggagg gcaggtcgat tggttggacg agcagcatcc gctgaccatt tcccgaccgc 961 caagagcagg acgcagcgag cggcaggcag aagaggatca ggtggaccgc tgtcgtctct 1021 ttgtcgaggg ggatcccacc aagaatgagc tgtacagccc cgagtatccc aacttgtatc 1081 cgaagaacat caactgcacc cgggtgataa cagcgccaaa gggacaaatc atacgcctgg 1141 actttcgcaa ctcgtttaat atcgaggcca aggaggggtg caaatttgat tttctcgaaa 1201 tacgagatgg ccagtacggt ttctctacgc tgattggcaa gttctgcggc accgactttc 1261 cgccggagat cacctcgaag gagcggtatt tgtggcttca tttccactcc gacgagacca 1321 tcgagtacac cggattcagt gcggtctatg agtatctgga caggagtcgg gatgcgccca 1381 gcaccgatct caactgcacc atcgataagg gcggcttcga gggcttcatc aactccacgg 1441 atgttccggc cgagatctgg gagcaggtca atcgcaataa gatcgcgctg gactgcatct 1501 ggcgcattca ggtcaaggag aattggaaga tatttctcaa gtttctggac ttcaagctga 1561 gcaagccgaa cgattgtcaa accaacttcc tggatatatt cccggagcag acggtgatgc 1621 cactgagggt taagaacttt tgcggttcag ctggcgagag tattacggcg gagtcaaata 1681 tcctgcactt gcgcttctac gcagatcaaa ccgcgattaa ctcgacattt ggcattctgt 1741 tcacggcgtt ccgggaacgt ggagctgcct gcaccgagga cgagtacgat tgcgaggacg 1801 cgacctgcat atcaaaggat ttgaaatgta ataacctaga caattgtaaa tttcgatggg 1861 acgaggaggg ctgcacgagc gaggcggccg gccaatcgga gcacgtggtc atcatcgtga 1921 ttgtgtttgg cctgatactc ggcggaatgg tcattacgtt catcgtcaat tgcatacgca 1981 agataatacg tgatcagaag ataatacgcg acgtgcccgc gttgagtgac ggaatctatc 2041 acattgattc ctttatactg gaagcgccca agagcgcgat tttcgtggga ttacagaatg 2101 atttcatgtg cgatttctcc tactcatcgg acgggcaaat ggcgcccaac ttggggcatg 2161 agacccgaga tgaggaggcc gcagttggtg gcgattccga ctttgattcg cagatggact 2221 cgccgaagca gacgtgtgac tgtgatttcg agttggatgt gaacgatggc gaacaaatgg 2281 aggaagacga tgaagaggag ctggaggaag agcaggagca ggaccatcat gtggaggatc 2341 aggagtacga cgatggcatt ggtttcagtt gtgacagcga cagcggactc acactgcccg 2401 aggacgatga tgagtttgta ctggtcaccg gacagtgtct gcccagcaac tccagtcact 2461 cgtgcagcag ttcgatgcaa tgcagcagcg gttctagtgg cagagaggtg gctactagct 2521 cctcaaactc catggaactg gacatggttc taacaccgcc accgccacca acactgggca 2581 agcccaagtc cggtgtacat cccctcaagt tcctgcacaa aatcatctag aaaagaaact 2641 cattcgaaat tcattcgctc acgttctgcg gtggtgaagg tggttcagtg accacctgct 2701 gctgctgcat gcaaatctgc atcgacatca ttaaaatcag gctggccgaa attgcgcaaa 2761 aaaaagaaaa aagaaagaga aatgcgatat cgaacccata ccattgtgac ccgaccttcg 2821 ctttgcccac gtagttcgtg ctgagttcac cgcaaaccag aaatcagaac aaaatcaaat 2881 ccttgatcct tggggggatt tgcagttcga cgtcattttc ccctcattag ttaagctgct 2941 aattgtgtgg cgggctatat cctagatata cgccccctta ggtaggaata cagttaacag 3001 tattatggat ataacctcat taaaaggctt acagtttata gaaagtatta tgcgaaaaat 3061 gatggcaacc aaggtggatc aaatataaat aaaacgattt atgcattgag tcttggcgca 3121 attgaataat tttacagagc cctgtgatcc acgtttctta accctaagta gctattgaaa 3181 ttttaataat ttaatgttct cattggacgg acaatcgtgc aatgcaaagc taagtaaata 3241 gttaactgtt ggctaaacga atggctgcca aaactaatac cgcacaaggg ctatatacga 3301 gtatataact atatatatat ataaatatat atataaatga aaaataaata tcttacaaaa 3361 tt