Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_167292 7308 bp mRNA linear INV 26-DEC-2023 transcript variant B (Ptp10D), mRNA. ACCESSION NM_167292 VERSION NM_167292.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 7308) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 7308) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 7308) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 7308) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 7308) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 7308) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 7308) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 7308) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 7308) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 7308) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 7308) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 7308) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 7308) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 7308) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 7308) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 7308) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 7308) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 7308) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jan 16, 2013 this sequence version replaced NM_167292.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..7308 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..7308 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Protein tyrosine phosphatase 10D" /map="10D1-10D4" /db_xref="FLYBASE:FBgn0004370" /db_xref="GeneID:32115" CDS 445..5340 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /EC_number="3.1.3.-" /EC_number="3.1.3.48" /note="CG1817 gene product from transcript CG1817-RB; CG1817-PB; Ptp10D-PB; protein tyrosine phosphatase 10B" /codon_start=1 /product="protein tyrosine phosphatase 10D, isoform B" /protein_id="NP_727544.2" /db_xref="FLYBASE:FBpp0073369" /db_xref="GeneID:32115" /db_xref="FLYBASE:FBgn0004370" /translation="MLYQLSKATTRIRLKRQKAVPQHRWLWSLAFLAAFTLKDVRCAD LAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWL YYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLG LSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPN TPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLW EAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGKV TSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIVYHELETFNGD TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPSSPIIEDLKSIR MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVIKNLQPGAGYELKVFAV SHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQ QWVRLPSVRSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQL VDSRNITLEWPKPEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELM PGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ SSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLPI QRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNE ITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPS EINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVF KIQAKTAIGFGPEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNG QVRMYTIIVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGT ENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITV PLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYR LMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDD DEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGR EKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPD FGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYV DIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKENIVGPAREMHDNEGYEGQQV QLDENGDVVATIEGHLSHHDLQQAEAEAIDDENAAILHDDQQPLTSSFTGHHTHMPPT TSMSSFGGGGGGHTNVDAPDR" misc_feature <586..1674 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(811..813,1006..1008,1051..1053) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 814..1059 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(1054..1059,1063..1068) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(1093..1095,1294..1296,1339..1341) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 1102..1356 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(1342..1347,1351..1356) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 1657..1926 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(1657..1659,1846..1848,1891..1893) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(1894..1899,1903..1908) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 1975..2166 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature <2098..>2556 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2461..2463,2665..2667,2710..2712) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 2491..2697 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 2803..2994 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cl21522" /db_xref="CDD:473895" misc_feature order(2998..3003,3007..3012) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3034..3036,3208..3210,3253..3255) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3040..3249 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(3316..3318,3514..3516,3559..3561) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3319..3573 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3691..4005 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="TM proximal of protein tyrosine phosphatase, receptor type J; Region: PTP_tm; pfam18861" /db_xref="CDD:465889" misc_feature 4345..5010 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="catalytic domain of R3 subfamily receptor-type tyrosine-protein phosphatases and similar proteins; Region: R3-PTPc; cd14548" /db_xref="CDD:350396" ORIGIN 1 atcagattcc aattcagtgt ggtgaagagc gaaccggagt gcggacggta cggacgcgaa 61 atctgttaag gcgggccgca aagcaaacgc tcgaaaaacg caaaatttgt cgattgtccg 121 ttccgctttt ttcttgtgtc tgtgctttgc gtcgcgtgcc tgcgtgtacg tcaattggat 181 tcaggataaa aatttacaaa atttcaccac actaacggga aaactgtgaa aacaatgcat 241 ttaatcaaag taaagactaa actcgcgcta aaaatgcccg aattcgaaag aaactagcga 301 aaagcccaat tcaaaaatcg cacaataaat tgcaaagtcc aaagcaacaa caacatagga 361 acaaataaaa caagaagcag gcaacaaaag agagccaggc ggagaggaaa acaacaacga 421 aaacagcaaa acgacggccc caaaatgttg taccagctaa gtaaagccac tactagaatc 481 cggctcaaaa ggcaaaaagc cgttccacaa catcgctggc tctggagttt agcatttctg 541 gcagcattta cactaaagga cgttcgatgt gcagatctag ccataagtat acccaataat 601 cccggcctgg acgatggggc ctcctatcga ctggactata gtccgccctt cggttatccg 661 gagcccaaca cgacgattgc ctcgcgggaa atcggcgatg agattcaatt ctcacgcgcc 721 ctaccgggca ccaaatacaa cttttggctg tactacacga actttacgca ccacgattgg 781 ctcacctgga cggtgacgat aacaacggct cccgatccgc cgtcgaatct gtccgttcag 841 gtgagaagcg gcaagaatgc catcatccta tggtcaccgc ccacccaggg cagctatacg 901 gcgtttaaga tcaaggtgct cggactgtcg gaggcgtcga gcagctacaa ccgcaccttt 961 caggtgaacg acaatacatt ccagcacagc gtcaaggagc tgacacccgg agccacctac 1021 caggtgcagg catataccat ctacgatggc aaggagtcgg tggcctacac tagtcgcaac 1081 ttcaccacaa agcccaacac tccggggaaa ttcatcgtct ggttccgtaa tgagacgaca 1141 ctgctggtcc tgtggcagcc gccatatccg gcgggcatct acacgcacta caaggtatcc 1201 atcgagccgc cggatgccaa cgatagtgtg ctctatgtgg aaaaggaggg cgaaccgccc 1261 ggaccggcgc aggctgcctt caagggtctg gtgcccggaa gggcgtacaa catatccgtt 1321 cagacgatgt ccgaggatga gatctcattg ccgacgacgg cgcaatatcg aacggtgccg 1381 ttgcgtccgc tgaacgtgac ctttgaccgt gactttatta cctccaattc gttccgtgtc 1441 ctgtgggagg cgcccaaggg gatatccgaa tttgacaaat accaggtatc ggtggccaca 1501 acacgacgcc aatccacagt gccgcgcagc aatgaaccgg tggcattctt tgattttcgc 1561 gacatcgccg aaccgggcaa gacgttcaat gtgatcgtga agaccgtatc cggcaaggtt 1621 acctcgtggc cagccaccgg ggatgtgaca ctgcgaccac tgcccgttcg caatttgcgg 1681 agcatcaacg atgacaagac gaatactatg atcataacgt gggaagcgga tccggccagc 1741 acgcaggatg agtatcgcat tgtataccac gaactggaga catttaatgg tgacaccagt 1801 accctgacca cggatcggac tcgattcaca ctggagagcc tgctacccgg tcgcaactac 1861 tcattgtccg tccaggcggt atccaagaag atggaatcga atgagactag catctttgtg 1921 gtcacccgac cctcgtcgcc catcatcgag gacttgaaga gcatacggat gggtctgaac 1981 atcagttgga agagcgatgt caactccaag caggagcagt acgaggtgtt gtactcgcgc 2041 aacggaacca gcgatttgcg aacccaaaag accaaagagt cgcgtctggt gatcaagaat 2101 ctgcagccag gtgctggcta tgaactcaag gtgtttgcag ttagtcacga tttgcgcagc 2161 gaaccacatg cctatttcca agcagtttat cccaatccac cacgcaacat gaccatcgaa 2221 acggtgagga gtaactcggt gctggtacac tggtcaccgc cggaaagcgg tgaatttacc 2281 gagtactcga tacgctatcg cacggacagc gaacagcagt gggtgcgatt gcccagcgtt 2341 cggtccacgg aggcggatat caccgatatg accaagggcg aaaagtacac catccaggtg 2401 aacacggtca gctttggcgt agagagtcca gtgccccagg aggtgaacac gacggtgccg 2461 ccgaatccgg tgtccaatat cattcaactg gtggactcac ggaacattac gttggagtgg 2521 cccaagccag agggtcgcgt ggaatcgtac attcttaagt ggtggcccag cgataatccc 2581 ggtcgtgtcc agaccaagaa tgtctccgag aacaagtcgg ccgacgattt gtcaacagtg 2641 cgtgtcctca tcggcgaact gatgcccggc gtgcagtaca agtttgacat ccagacgacg 2701 tcgtatggaa tcctgtcggg catcaccagt ctgtatccgc gcaccatgcc gctcatccag 2761 tcggacgtgg tggtggccaa tggcgagaag gaggacgaga gggacaccat cactctgagc 2821 tacacaccca caccgcagtc gtcgtccaag ttcgatatct atcgattctc tctcggcgat 2881 gccgagatcc gggacaagga gaagctggcc aacgatacgg atcgcaaggt gacgtttacg 2941 ggtctggtgc ctggtcgatt gtacaacatc acagtttgga ctgtgagcgg tggtgtggcc 3001 agtttgccca tacaacgaca ggatcgcctg tatccggaac ccatcacaca gctgcatgcc 3061 accaacatca cggatacgga gatctcattg cgctgggatt tgcccaaggg cgagtacaat 3121 gacttcgata ttgcctatct cacggcggac aatctattgg cccagaatat gaccaccagg 3181 aatgagatca ccatcagtga cctgcgaccc cacaggaact acaccttcac cgtggtggta 3241 cgttccggca ctgaatcgtc cgtgctgagg agcagttcac cattatccgc tagctttacg 3301 accaatgaag cggtgcccgg gcgagttgaa cgcttccatc ccacggatgt tcagcccagc 3361 gagatcaatt tcgagtggtc gctgccatcg agtgaggcaa atggcgttat tcgccagttc 3421 tcgatagcct atacgaatat caataatctc acggacgcag gcatgcagga ctttgagtcg 3481 gaggaggcat tcggtgtgat caagaatcta aagcccggcg agacctatgt gttcaagatt 3541 caggccaaga ctgccatcgg tttcggtccg gagcgggagt accgtcaaac gatgccgata 3601 ttagcgccac cacgtcctgc cacccaagtg gtgcccaccg aggtctatcg cagctcatcg 3661 accatccaga ttcggtttag gaagaactac ttctcggatc aaaacggcca ggtgcgcatg 3721 tacacgatca tcgtggccga ggatgatgcc aagaatgcat ccggcctgga gatgcccagc 3781 tggctggatg tgcagtcgta cagcgtttgg ttgccctatc aggccataga tccgtactat 3841 ccattcgaga atcgatccgt agaggacttc accatcggta cggagaactg tgacaaccac 3901 aagatcggct actgcaacgg accactgaaa tcgggaacca cctatcgggt taaggtgcgg 3961 gcgttcaccg gagcggataa gttcacggat accgcctaca gttttcccat tcagacagat 4021 caagacaaca cctcactgat tgtggccatt acggtgccgt taactatcat cttggtgctc 4081 ctggtgacac ttttgttcta caaacgacgt cgcaacaatt gccgtaagac gaccaaggat 4141 tcgagggcca acgacaatat gtccctgccg gatagcgtaa tcgagcagaa tcgccccatt 4201 ctgatcaaga actttgccga gcactatcgc ctaatgtccg ccgattcgga cttccgtttc 4261 agcgaggaat tcgaggaact gaagcacgtt ggccgggatc agccgtgcac ttttgccgat 4321 ctaccctgca atcgtccgaa aaacaggttc accaatatac tgccctacga tcactcacgt 4381 ttcaagcttc agccggtgga cgatgatgag ggtagtgatt atatcaatgc caattacgtg 4441 ccgggtcaca attcaccgcg cgagttcatc gtgacccagg gaccattgca ttcgacacgc 4501 gatgacttct ggcgaatgtg ctgggagagc aactcgcggg ccatagtcat gctgaccagg 4561 tgctttgaga aggggcgcga gaagtgcgac cagtattggc caaatgatac ggtgcccgtc 4621 ttctacggtg acatcaaggt gcagatactc aacgacagtc actatgccga ctgggtgatg 4681 accgagttca tgctatgcag aggcagcgaa cagcgcatcc tgcgacactt ccacttcacc 4741 acctggccgg acttcggtgt tcccaatccg ccacagacac tggtgcgctt tgtgcgcgca 4801 ttccgcgatc gaattggtgc ggaacagcga cccattgtgg tccattgtag cgccggtgtg 4861 ggaaggtcgg gcaccttcat caccctggat cgcatcctgc aacagatcaa cacgtctgac 4921 tatgtggaca tatttggcat agtatatgcc atgcgcaagg agcgcgtttg gatggtgcag 4981 acggagcagc agtatatctg catccaccag tgcctgctgg cggtgctcga ggggaaggag 5041 aacatcgtgg gtcccgctcg cgagatgcac gacaacgagg gctatgaagg ccaacaagtg 5101 cagctggacg agaacggtga tgtggtggcc accattgagg gtcacctgtc gcatcatgat 5161 ctgcagcagg ccgaggcgga ggccattgac gatgagaatg cggcgatact ccatgatgac 5221 cagcagccgc tgaccagtag ctttactgga caccacactc acatgccgcc caccacatcg 5281 atgagctcat ttggcggcgg aggtggaggc catacaaatg tggatgcacc ggatagatga 5341 cattcggttg tcaaccagag tgataacaac aattcggtgg ttatcgtcct ggttgacaac 5401 aagcccagct cgatgatctg caaggatagc aagggcggca acatcgatgt gctcgaatcg 5461 cagcagcagc agcagcagca acagcaacag cagcccaacc agggaggcca caacataacc 5521 accatatccg ccatcaacgg ctacaatacg ctacagcata gacggaaatc ccagctgata 5581 acgttcagct cgtcatcctg tgatatcaag aacagtctta gtcatgagta catcaatgga 5641 tccaatggat cggcagctaa tggtccaccc agttccggtt ctggttccgg ttccggtcca 5701 ggcagcaatc gggccagtcg cgccaatgtc cgattaagtt tcgccgagga agatgtaatg 5761 atcttgccac aaaaccacag tcagcaatcc aatcatcaag atgacgaggt cttcacgcga 5821 cgtcgttcgc ttttggaagt ggaaatcggt gtggaggtag gcgaagatgg tgaacttgca 5881 ccccacgaaa tggaagagga tctcgaagag gaggacgagg atgaggagct gtatatgcac 5941 gatgagttcg agacccacat cgataccaag tcgaataatg ccaacgatga cagcggtggc 6001 ggcagctacg aggactccca tgccctgcac tcctcgctgg ggggcagtaa tcgaaatagt 6061 ctggaaaagg atgacgacga catcgaggtg gatgtgatca gcacagacgt tagctgttac 6121 gatcaactgc tcggcagcag ttgcaacacg cggaacggcg atgatgacga catagccacg 6181 ctggtcggcg atggcgacta ttccaccacg aaactcagca aggcatccag attatccggc 6241 gctggagtcg gcggactagt ggtcagcggg ggaggaggtg gaactgcaat cggcggtgga 6301 atcgctgtta acggtggtgg tgttttggga aatggtgttg gttccgaggc tggcggcggc 6361 atcatctatg ccaatccgtt tatggatgac gagggcattg cagagtcggg catgtaaagc 6421 cattccaaaa cccaatactc cagccaatcc aagccagcca gccagccaac caagcaactg 6481 aactcaactc aaccgaatgg aaacccaacc caacccaaca gaacccaacc atcttgtggc 6541 aactacatta ttatttactt aagggacgaa gtgcgaagag agcgcggagg aggatcaacg 6601 cttgatatta tacttggata tatgtgtact acactggata ctactggata tatatatata 6661 tatatactct acaccgcgat ctatcgaatg ggaatgcagc aatctcgcca aacagaacga 6721 acacgcatca atttatacat tttatatata tataaagata tatatatcta agataacgag 6781 gaatcggcgt acaatgtaac cgcaattgcc gcttcaaacc gacggcaata ctaaatactg 6841 gaatactgat tgtattttta cgctagccac aatttgatat aaactatata tcttccaatt 6901 tttttgtaca cctaatgtta gttgaaatat gtgagcgaga cgagcaaatt tttgtagcaa 6961 actaaaagcg ctaaatgttt acttttttat attattatat atataaatac ttgataaaca 7021 tatacctaat attagatcta aactaaacta actataaatc gcacacactc atacactcac 7081 acaaaaacac aatgcaataa ttgagttaca tagttttaaa caaatgttaa aacattttgc 7141 tgcaaccgtc ggagatgtag tgtacaattt ttagtttctc gtattatttt tttttttatg 7201 tctgttttgt gtttaaattt tttgtaactt tttacaaagc gtaaactgtg tatgtatgtg 7261 ctacattgat ttttgtttaa ttatatcaag tttttattta aaaaatcg