Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster protein tyrosine phosphatase 10D,


LOCUS       NM_167292               7308 bp    mRNA    linear   INV 26-DEC-2023
            transcript variant B (Ptp10D), mRNA.
ACCESSION   NM_167292
VERSION     NM_167292.3
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 7308)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7308)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 7308)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 7308)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 7308)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 7308)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 7308)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 7308)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 7308)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 7308)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 7308)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 7308)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 7308)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 7308)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 7308)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 7308)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 7308)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 7308)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 16, 2013 this sequence version replaced NM_167292.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..7308
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..7308
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Protein tyrosine phosphatase 10D"
                     /map="10D1-10D4"
                     /db_xref="FLYBASE:FBgn0004370"
                     /db_xref="GeneID:32115"
     CDS             445..5340
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /EC_number="3.1.3.-"
                     /EC_number="3.1.3.48"
                     /note="CG1817 gene product from transcript CG1817-RB;
                     CG1817-PB; Ptp10D-PB; protein tyrosine phosphatase 10B"
                     /codon_start=1
                     /product="protein tyrosine phosphatase 10D, isoform B"
                     /protein_id="NP_727544.2"
                     /db_xref="FLYBASE:FBpp0073369"
                     /db_xref="GeneID:32115"
                     /db_xref="FLYBASE:FBgn0004370"
                     /translation="MLYQLSKATTRIRLKRQKAVPQHRWLWSLAFLAAFTLKDVRCAD
                     LAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWL
                     YYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLG
                     LSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPN
                     TPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ
                     AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLW
                     EAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGKV
                     TSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIVYHELETFNGD
                     TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPSSPIIEDLKSIR
                     MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVIKNLQPGAGYELKVFAV
                     SHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQ
                     QWVRLPSVRSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQL
                     VDSRNITLEWPKPEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELM
                     PGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ
                     SSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLPI
                     QRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNE
                     ITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPS
                     EINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVF
                     KIQAKTAIGFGPEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNG
                     QVRMYTIIVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGT
                     ENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITV
                     PLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYR
                     LMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDD
                     DEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGR
                     EKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPD
                     FGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYV
                     DIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKENIVGPAREMHDNEGYEGQQV
                     QLDENGDVVATIEGHLSHHDLQQAEAEAIDDENAAILHDDQQPLTSSFTGHHTHMPPT
                     TSMSSFGGGGGGHTNVDAPDR"
     misc_feature    <586..1674
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(811..813,1006..1008,1051..1053)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    814..1059
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1054..1059,1063..1068)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(1093..1095,1294..1296,1339..1341)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    1102..1356
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1342..1347,1351..1356)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    1657..1926
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(1657..1659,1846..1848,1891..1893)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(1894..1899,1903..1908)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    1975..2166
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    <2098..>2556
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2461..2463,2665..2667,2710..2712)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    2491..2697
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    2803..2994
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cl21522"
                     /db_xref="CDD:473895"
     misc_feature    order(2998..3003,3007..3012)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3034..3036,3208..3210,3253..3255)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3040..3249
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(3316..3318,3514..3516,3559..3561)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3319..3573
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3691..4005
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="TM proximal of protein tyrosine phosphatase,
                     receptor type J; Region: PTP_tm; pfam18861"
                     /db_xref="CDD:465889"
     misc_feature    4345..5010
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="catalytic domain of R3 subfamily receptor-type
                     tyrosine-protein phosphatases and similar proteins;
                     Region: R3-PTPc; cd14548"
                     /db_xref="CDD:350396"
ORIGIN      
        1 atcagattcc aattcagtgt ggtgaagagc gaaccggagt gcggacggta cggacgcgaa
       61 atctgttaag gcgggccgca aagcaaacgc tcgaaaaacg caaaatttgt cgattgtccg
      121 ttccgctttt ttcttgtgtc tgtgctttgc gtcgcgtgcc tgcgtgtacg tcaattggat
      181 tcaggataaa aatttacaaa atttcaccac actaacggga aaactgtgaa aacaatgcat
      241 ttaatcaaag taaagactaa actcgcgcta aaaatgcccg aattcgaaag aaactagcga
      301 aaagcccaat tcaaaaatcg cacaataaat tgcaaagtcc aaagcaacaa caacatagga
      361 acaaataaaa caagaagcag gcaacaaaag agagccaggc ggagaggaaa acaacaacga
      421 aaacagcaaa acgacggccc caaaatgttg taccagctaa gtaaagccac tactagaatc
      481 cggctcaaaa ggcaaaaagc cgttccacaa catcgctggc tctggagttt agcatttctg
      541 gcagcattta cactaaagga cgttcgatgt gcagatctag ccataagtat acccaataat
      601 cccggcctgg acgatggggc ctcctatcga ctggactata gtccgccctt cggttatccg
      661 gagcccaaca cgacgattgc ctcgcgggaa atcggcgatg agattcaatt ctcacgcgcc
      721 ctaccgggca ccaaatacaa cttttggctg tactacacga actttacgca ccacgattgg
      781 ctcacctgga cggtgacgat aacaacggct cccgatccgc cgtcgaatct gtccgttcag
      841 gtgagaagcg gcaagaatgc catcatccta tggtcaccgc ccacccaggg cagctatacg
      901 gcgtttaaga tcaaggtgct cggactgtcg gaggcgtcga gcagctacaa ccgcaccttt
      961 caggtgaacg acaatacatt ccagcacagc gtcaaggagc tgacacccgg agccacctac
     1021 caggtgcagg catataccat ctacgatggc aaggagtcgg tggcctacac tagtcgcaac
     1081 ttcaccacaa agcccaacac tccggggaaa ttcatcgtct ggttccgtaa tgagacgaca
     1141 ctgctggtcc tgtggcagcc gccatatccg gcgggcatct acacgcacta caaggtatcc
     1201 atcgagccgc cggatgccaa cgatagtgtg ctctatgtgg aaaaggaggg cgaaccgccc
     1261 ggaccggcgc aggctgcctt caagggtctg gtgcccggaa gggcgtacaa catatccgtt
     1321 cagacgatgt ccgaggatga gatctcattg ccgacgacgg cgcaatatcg aacggtgccg
     1381 ttgcgtccgc tgaacgtgac ctttgaccgt gactttatta cctccaattc gttccgtgtc
     1441 ctgtgggagg cgcccaaggg gatatccgaa tttgacaaat accaggtatc ggtggccaca
     1501 acacgacgcc aatccacagt gccgcgcagc aatgaaccgg tggcattctt tgattttcgc
     1561 gacatcgccg aaccgggcaa gacgttcaat gtgatcgtga agaccgtatc cggcaaggtt
     1621 acctcgtggc cagccaccgg ggatgtgaca ctgcgaccac tgcccgttcg caatttgcgg
     1681 agcatcaacg atgacaagac gaatactatg atcataacgt gggaagcgga tccggccagc
     1741 acgcaggatg agtatcgcat tgtataccac gaactggaga catttaatgg tgacaccagt
     1801 accctgacca cggatcggac tcgattcaca ctggagagcc tgctacccgg tcgcaactac
     1861 tcattgtccg tccaggcggt atccaagaag atggaatcga atgagactag catctttgtg
     1921 gtcacccgac cctcgtcgcc catcatcgag gacttgaaga gcatacggat gggtctgaac
     1981 atcagttgga agagcgatgt caactccaag caggagcagt acgaggtgtt gtactcgcgc
     2041 aacggaacca gcgatttgcg aacccaaaag accaaagagt cgcgtctggt gatcaagaat
     2101 ctgcagccag gtgctggcta tgaactcaag gtgtttgcag ttagtcacga tttgcgcagc
     2161 gaaccacatg cctatttcca agcagtttat cccaatccac cacgcaacat gaccatcgaa
     2221 acggtgagga gtaactcggt gctggtacac tggtcaccgc cggaaagcgg tgaatttacc
     2281 gagtactcga tacgctatcg cacggacagc gaacagcagt gggtgcgatt gcccagcgtt
     2341 cggtccacgg aggcggatat caccgatatg accaagggcg aaaagtacac catccaggtg
     2401 aacacggtca gctttggcgt agagagtcca gtgccccagg aggtgaacac gacggtgccg
     2461 ccgaatccgg tgtccaatat cattcaactg gtggactcac ggaacattac gttggagtgg
     2521 cccaagccag agggtcgcgt ggaatcgtac attcttaagt ggtggcccag cgataatccc
     2581 ggtcgtgtcc agaccaagaa tgtctccgag aacaagtcgg ccgacgattt gtcaacagtg
     2641 cgtgtcctca tcggcgaact gatgcccggc gtgcagtaca agtttgacat ccagacgacg
     2701 tcgtatggaa tcctgtcggg catcaccagt ctgtatccgc gcaccatgcc gctcatccag
     2761 tcggacgtgg tggtggccaa tggcgagaag gaggacgaga gggacaccat cactctgagc
     2821 tacacaccca caccgcagtc gtcgtccaag ttcgatatct atcgattctc tctcggcgat
     2881 gccgagatcc gggacaagga gaagctggcc aacgatacgg atcgcaaggt gacgtttacg
     2941 ggtctggtgc ctggtcgatt gtacaacatc acagtttgga ctgtgagcgg tggtgtggcc
     3001 agtttgccca tacaacgaca ggatcgcctg tatccggaac ccatcacaca gctgcatgcc
     3061 accaacatca cggatacgga gatctcattg cgctgggatt tgcccaaggg cgagtacaat
     3121 gacttcgata ttgcctatct cacggcggac aatctattgg cccagaatat gaccaccagg
     3181 aatgagatca ccatcagtga cctgcgaccc cacaggaact acaccttcac cgtggtggta
     3241 cgttccggca ctgaatcgtc cgtgctgagg agcagttcac cattatccgc tagctttacg
     3301 accaatgaag cggtgcccgg gcgagttgaa cgcttccatc ccacggatgt tcagcccagc
     3361 gagatcaatt tcgagtggtc gctgccatcg agtgaggcaa atggcgttat tcgccagttc
     3421 tcgatagcct atacgaatat caataatctc acggacgcag gcatgcagga ctttgagtcg
     3481 gaggaggcat tcggtgtgat caagaatcta aagcccggcg agacctatgt gttcaagatt
     3541 caggccaaga ctgccatcgg tttcggtccg gagcgggagt accgtcaaac gatgccgata
     3601 ttagcgccac cacgtcctgc cacccaagtg gtgcccaccg aggtctatcg cagctcatcg
     3661 accatccaga ttcggtttag gaagaactac ttctcggatc aaaacggcca ggtgcgcatg
     3721 tacacgatca tcgtggccga ggatgatgcc aagaatgcat ccggcctgga gatgcccagc
     3781 tggctggatg tgcagtcgta cagcgtttgg ttgccctatc aggccataga tccgtactat
     3841 ccattcgaga atcgatccgt agaggacttc accatcggta cggagaactg tgacaaccac
     3901 aagatcggct actgcaacgg accactgaaa tcgggaacca cctatcgggt taaggtgcgg
     3961 gcgttcaccg gagcggataa gttcacggat accgcctaca gttttcccat tcagacagat
     4021 caagacaaca cctcactgat tgtggccatt acggtgccgt taactatcat cttggtgctc
     4081 ctggtgacac ttttgttcta caaacgacgt cgcaacaatt gccgtaagac gaccaaggat
     4141 tcgagggcca acgacaatat gtccctgccg gatagcgtaa tcgagcagaa tcgccccatt
     4201 ctgatcaaga actttgccga gcactatcgc ctaatgtccg ccgattcgga cttccgtttc
     4261 agcgaggaat tcgaggaact gaagcacgtt ggccgggatc agccgtgcac ttttgccgat
     4321 ctaccctgca atcgtccgaa aaacaggttc accaatatac tgccctacga tcactcacgt
     4381 ttcaagcttc agccggtgga cgatgatgag ggtagtgatt atatcaatgc caattacgtg
     4441 ccgggtcaca attcaccgcg cgagttcatc gtgacccagg gaccattgca ttcgacacgc
     4501 gatgacttct ggcgaatgtg ctgggagagc aactcgcggg ccatagtcat gctgaccagg
     4561 tgctttgaga aggggcgcga gaagtgcgac cagtattggc caaatgatac ggtgcccgtc
     4621 ttctacggtg acatcaaggt gcagatactc aacgacagtc actatgccga ctgggtgatg
     4681 accgagttca tgctatgcag aggcagcgaa cagcgcatcc tgcgacactt ccacttcacc
     4741 acctggccgg acttcggtgt tcccaatccg ccacagacac tggtgcgctt tgtgcgcgca
     4801 ttccgcgatc gaattggtgc ggaacagcga cccattgtgg tccattgtag cgccggtgtg
     4861 ggaaggtcgg gcaccttcat caccctggat cgcatcctgc aacagatcaa cacgtctgac
     4921 tatgtggaca tatttggcat agtatatgcc atgcgcaagg agcgcgtttg gatggtgcag
     4981 acggagcagc agtatatctg catccaccag tgcctgctgg cggtgctcga ggggaaggag
     5041 aacatcgtgg gtcccgctcg cgagatgcac gacaacgagg gctatgaagg ccaacaagtg
     5101 cagctggacg agaacggtga tgtggtggcc accattgagg gtcacctgtc gcatcatgat
     5161 ctgcagcagg ccgaggcgga ggccattgac gatgagaatg cggcgatact ccatgatgac
     5221 cagcagccgc tgaccagtag ctttactgga caccacactc acatgccgcc caccacatcg
     5281 atgagctcat ttggcggcgg aggtggaggc catacaaatg tggatgcacc ggatagatga
     5341 cattcggttg tcaaccagag tgataacaac aattcggtgg ttatcgtcct ggttgacaac
     5401 aagcccagct cgatgatctg caaggatagc aagggcggca acatcgatgt gctcgaatcg
     5461 cagcagcagc agcagcagca acagcaacag cagcccaacc agggaggcca caacataacc
     5521 accatatccg ccatcaacgg ctacaatacg ctacagcata gacggaaatc ccagctgata
     5581 acgttcagct cgtcatcctg tgatatcaag aacagtctta gtcatgagta catcaatgga
     5641 tccaatggat cggcagctaa tggtccaccc agttccggtt ctggttccgg ttccggtcca
     5701 ggcagcaatc gggccagtcg cgccaatgtc cgattaagtt tcgccgagga agatgtaatg
     5761 atcttgccac aaaaccacag tcagcaatcc aatcatcaag atgacgaggt cttcacgcga
     5821 cgtcgttcgc ttttggaagt ggaaatcggt gtggaggtag gcgaagatgg tgaacttgca
     5881 ccccacgaaa tggaagagga tctcgaagag gaggacgagg atgaggagct gtatatgcac
     5941 gatgagttcg agacccacat cgataccaag tcgaataatg ccaacgatga cagcggtggc
     6001 ggcagctacg aggactccca tgccctgcac tcctcgctgg ggggcagtaa tcgaaatagt
     6061 ctggaaaagg atgacgacga catcgaggtg gatgtgatca gcacagacgt tagctgttac
     6121 gatcaactgc tcggcagcag ttgcaacacg cggaacggcg atgatgacga catagccacg
     6181 ctggtcggcg atggcgacta ttccaccacg aaactcagca aggcatccag attatccggc
     6241 gctggagtcg gcggactagt ggtcagcggg ggaggaggtg gaactgcaat cggcggtgga
     6301 atcgctgtta acggtggtgg tgttttggga aatggtgttg gttccgaggc tggcggcggc
     6361 atcatctatg ccaatccgtt tatggatgac gagggcattg cagagtcggg catgtaaagc
     6421 cattccaaaa cccaatactc cagccaatcc aagccagcca gccagccaac caagcaactg
     6481 aactcaactc aaccgaatgg aaacccaacc caacccaaca gaacccaacc atcttgtggc
     6541 aactacatta ttatttactt aagggacgaa gtgcgaagag agcgcggagg aggatcaacg
     6601 cttgatatta tacttggata tatgtgtact acactggata ctactggata tatatatata
     6661 tatatactct acaccgcgat ctatcgaatg ggaatgcagc aatctcgcca aacagaacga
     6721 acacgcatca atttatacat tttatatata tataaagata tatatatcta agataacgag
     6781 gaatcggcgt acaatgtaac cgcaattgcc gcttcaaacc gacggcaata ctaaatactg
     6841 gaatactgat tgtattttta cgctagccac aatttgatat aaactatata tcttccaatt
     6901 tttttgtaca cctaatgtta gttgaaatat gtgagcgaga cgagcaaatt tttgtagcaa
     6961 actaaaagcg ctaaatgttt acttttttat attattatat atataaatac ttgataaaca
     7021 tatacctaat attagatcta aactaaacta actataaatc gcacacactc atacactcac
     7081 acaaaaacac aatgcaataa ttgagttaca tagttttaaa caaatgttaa aacattttgc
     7141 tgcaaccgtc ggagatgtag tgtacaattt ttagtttctc gtattatttt tttttttatg
     7201 tctgttttgt gtttaaattt tttgtaactt tttacaaagc gtaaactgtg tatgtatgtg
     7261 ctacattgat ttttgtttaa ttatatcaag tttttattta aaaaatcg