Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster neuroglian, transcript variant B (Nrg),


LOCUS       NM_167160               4492 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_167160
VERSION     NM_167160.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 4492)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4492)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 4492)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 4492)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 4492)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 4492)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 4492)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 4492)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 4492)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 4492)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 4492)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 4492)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 4492)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 4492)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 4492)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 4492)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 4492)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 4492)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Dec 17, 2009 this sequence version replaced NM_167160.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4492
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..4492
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Neuroglian"
                     /map="7F2-7F4"
                     /db_xref="FLYBASE:FBgn0264975"
                     /db_xref="GeneID:31792"
     CDS             456..4364
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="CG1634 gene product from transcript CG1634-RB;
                     CG1634-PB; Nrg-PB; icebox; central brain deranged;
                     neuroglian; lethal (1) G0488; female sterile(1)M72"
                     /codon_start=1
                     /product="neuroglian, isoform B"
                     /protein_id="NP_727274.1"
                     /db_xref="FLYBASE:FBpp0071155"
                     /db_xref="GeneID:31792"
                     /db_xref="FLYBASE:FBgn0264975"
                     /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV
                     AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK
                     DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG
                     FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF
                     RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP
                     QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN
                     VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD
                     NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT
                     IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE
                     IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE
                     AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT
                     CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA
                     NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI
                     EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE
                     SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT
                     WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE
                     GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI
                     TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE
                     QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP
                     ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII
                     LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK
                     PGVESDTDSMAEYGDGDTGQFTEDGSFIGQYVPGKLQPPVSPQPLNNSAAAHQAAPTA
                     GGSGAAGSAAAAGASGGASSAGGAAASNGGAAAGAVATYV"
     misc_feature    540..839
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    618..632
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    657..671
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    735..749
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    777..794
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    819..830
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    864..1103
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    906..920
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    948..962
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1029..1043
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1080..1097
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1206..1451
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: ig; pfam00047"
                     /db_xref="CDD:395002"
     misc_feature    1245..1259
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1284..1298
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1368..1382
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1395..1412
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1437..1448
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1470..1736
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fourth immunoglobulin (Ig)-like domain of hemolin,
                     and similar domains; a member of the I-set of IgSF
                     domains; Region: IgI_4_hemolin-like; cd20978"
                     /db_xref="CDD:409570"
     misc_feature    1470..1481
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409570"
     misc_feature    1497..1508
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409570"
     misc_feature    1521..1544
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    1560..1577
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1584..1592
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409570"
     misc_feature    1614..1628
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409570"
     misc_feature    1632..1646
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1671..1697
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1704..1736
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    1791..2006
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1800..1814
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1839..1853
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1902..1916
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1944..1961
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1983..1994
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2016..2300
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2067..2081
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2112..2126
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2184..2198
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2226..2243
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2265..2276
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2292..2576
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    2502..>3608
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2541..2546,2550..2555)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2904..3170
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(3156..3161,3165..3170)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3204..3206,3414..3416,3459..3461)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3207..3476
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3576..3788
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(3765..3770,3774..3779)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    3918..4172
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Bravo-like intracellular region; Region:
                     Bravo_FIGEY; pfam13882"
                     /db_xref="CDD:464016"
ORIGIN      
        1 ccaaatcgta tttactgaaa actacgccga aaacaccgcg atacatattc gcagccgagc
       61 gaatatatat cgttatttgg gtgtttaagc actaacttta tttatttttt cctaaaaatt
      121 ccgcgtgtat aacataactg tcccagtgtg tgtgtatatg cgtcggtgtt agtgttagtg
      181 agcgccggga attgaaaata aaatatgcaa cagcagaaag taataaaagc tcggctcgca
      241 tgcaattttc attagtggga aaattgtttg atatttaaga ggcaaccgag gaataaacgg
      301 aatcaacagc agcagacaca cacacacaca ttccaagcca aattaataat agaaaagaaa
      361 aacaaaaaaa aaaaaacagc aaccagaaaa ccaataaaag tttaaaccaa aacgaaacac
      421 actcgagggg gcgagcggag agccaaacga ccaaaatgtg gcggcagtca acgatactgg
      481 ccgcgttact agtggctctt ttgtgtgcgg gcagtgcaga aagcaaaggc aatcgcccac
      541 caagaatcac caaacaaccg gcacccggag aattgctctt caaagtggcg caacagaata
      601 aggaaagtga caatccattc ataatcgagt gcgaagccga tggacaaccc gagccagaat
      661 atagttggat caagaacggc aagaagttcg attggcaggc gtacgataac cgcatgctgc
      721 ggcagccagg acgtggcacc ctggtgatca ccatacccaa ggacgaggat cgcggccact
      781 atcagtgctt tgcgtccaat gaattcggaa cggccacctc gaactcagta tatgtgcgta
      841 aggccgagct gaatgccttc aaggatgagg cggccaagac actggaggcc gtcgagggtg
      901 agccctttat gctgaaatgt gccgcacccg atggttttcc cagtccgaca gtcaactgga
      961 tgatccagga gtccatcgat ggcagcatca agtcgatcaa caactctcgc atgaccctcg
     1021 atcctgaggg taatctctgg ttctcgaatg ttacccgtga ggatgccagc tccgatttct
     1081 actatgcctg ctcggccacc tcggtgtttc gcagtgaata caagattggc aacaaggtgc
     1141 tcctcgatgt caaacagatg ggcgttagtg cctcgcagaa caagcatccg cccgtgcgtc
     1201 aatatgtttc ccgtcgccag tccttggcgt tgcgtggcaa gcgaatggaa ctgttttgca
     1261 tctacggtgg aacaccgctg ccgcagaccg tgtggagcaa ggatggccag cgtatacagt
     1321 ggagcgatcg aataacgcaa ggacactatg gcaaatcact ggtcattcgg cagacaaatt
     1381 tcgatgatgc cggcacatac acctgcgacg tgtccaacgg tgtgggcaat gcccaatcct
     1441 tctccatcat tctgaatgtt aactccgtgc cgtactttac caaagaacct gaaatcgcca
     1501 ccgccgccga agacgaagag gttgtcttcg agtgtcgcgc tgctggtgta ccagagccca
     1561 agatcagttg gattcacaat ggtaagccca tcgagcagag caccccgaat ccccgacgaa
     1621 cggttacgga caacacaatt cgcattatca atctggttaa gggcgatact ggtaactacg
     1681 gttgcaacgc caccaattcg ctgggatatg tgtataagga tgtctatcta aatgtccagg
     1741 ctgagccgcc aacgatttcc gaagctccag cagctgtatc cactgtcgat ggaaggaatg
     1801 tgaccattaa gtgcagggtt aacggttccc ccaagcctct ggttaaatgg ctaagggcca
     1861 gcaactggct gaccggaggt cgttacaatg tccaagctaa cggtgacctg gagatccaag
     1921 atgtgacatt ctcggatgcc ggcaaataca catgctatgc gcagaacaag tttggtgaaa
     1981 ttcaagccga tggttcgctg gtggtcaagg agcatacgag aattacccaa gagccgcaaa
     2041 actacgaggt ggccgccgga caatcggcca cgttccgctg taacgaggcc cacgacgata
     2101 cgctggagat tgagatcgat tggtggaagg atggccagtc cattgacttt gaggcccagc
     2161 cgcgattcgt gaagaccaat gataattccc tgacgattgc caagacaatg gagttggatt
     2221 ctggcgaata tacgtgcgtg gcccggacgc gtttggatga ggcaacggcc agggcgaatt
     2281 tgattgtcca ggatgtgccg aatgcaccaa aactgaccgg catcacctgc caggccgaca
     2341 aggccgagat ccactgggaa cagcagggtg acaatcgttc gcccattctg cactacacca
     2401 ttcagttcaa tacatcgttc acgcccgcct cctgggatgc cgcctacgag aaggtgccca
     2461 acacggactc ctcgttcgtc gtccagatgt caccgtgggc caactatacg ttccgtgtga
     2521 ttgccttcaa caagatcgga gcctcgccgc cgtcggcgca cagcgatagc tgcaccaccc
     2581 agccggatgt gcccttcaag aatcccgaca atgtcgttgg ccagggcact gagcccaaca
     2641 atctggtcat ctcgtggact cccatgcccg aaatcgagca caatgccccc aatttccatt
     2701 attatgttag ctggaaacgc gatattcctg ccgctgcgtg ggaaaacaat aacatattcg
     2761 actggcgaca gaacaacatt gtgattgccg atcaaccgac tttcgtgaaa tacctgatca
     2821 aggtggtggc catcaacgat aggggtgagt ccaatgtggc cgccgaggag gtggttggct
     2881 actctggcga agatcgtccc ctggatgcgc ccaccaactt cacaatgagg caaatcacat
     2941 catcgaccag tggctacatg gcctggacgc cggtaagtga ggaatcggtg cgcggacact
     3001 tcaagggcta caaaatccaa acgtggacgg agaacgaggg cgaggagggt ctgcgggaga
     3061 tccatgtgaa gggtgatacc cacaacgctc tggtcacaca attcaagccc gattcaaaga
     3121 actatgcccg cattttggct tacaatggac gcttcaatgg cccacccagt gccgtcatcg
     3181 acttcgatac tccggagggt gtaccatcgc cggttcaggg actggatgcc tatcctctgg
     3241 gctcctcggc cttcatgctc cactggaaga agccgctgta tcccaatggc aagctcactg
     3301 gctacaagat ctactacgag gaggttaagg agagctatgt gggcgagcga cgcgaatacg
     3361 atccacacat caccgatccc agggtcacac gcatgaagat ggccggcctg aagcccaact
     3421 ccaagtaccg catctccatc actgccacca cgaaaatggg cgagggatct gaacactata
     3481 tcgaaaagac cacgctcaag gatgccgtca atgtggcccc tgccacgcca tctttctcct
     3541 gggagcaact gccatccgac aatggactag ccaagttccg catcaactgg ctgccaagta
     3601 ccgagggtca tccaggcact cacttcttta cgatgcacag gatcaagggc gaaacccaat
     3661 ggatacgcga gaatgaggaa aagaactccg attaccagga ggtcggtggc ttagatccgg
     3721 agaccgccta cgagttccgc gtggtgtccg tggatggcca ctttaacacg gagagtgcca
     3781 cgcaggagat cgacacgaac accgttgagg gaccaataat ggtggccaac gagacggtgg
     3841 ccaatgccgg atggttcatt ggcatgatgc tggccctggc cttcatcatc atcctcttca
     3901 tcatcatctg cattatccga cgcaatcggg gcggaaagta cgatgtccac gatcgggagc
     3961 tggccaacgg ccggcgggat tatcccgaag agggcggatt ccacgagtac tcgcaaccgt
     4021 tggataacaa gagcgctggt cgccaatccg tgagttcagc gaacaaaccg ggcgtggaaa
     4081 gcgatactga ttcgatggcc gaatacggtg atggcgatac aggacaattt accgaggatg
     4141 gctccttcat tggccaatat gttcctggaa agctccaacc gccggttagc ccacagccac
     4201 tgaacaattc cgctgcggcg catcaggcgg cgccaactgc cggaggatcg ggagcagccg
     4261 gatcggcagc agcagccgga gcatcgggtg gagcatcgtc cgccggagga gcagctgcca
     4321 gcaatggagg agctgcagcc ggagccgtgg ccacctacgt ctaagaggcg tggctgggat
     4381 tcacttgccc cattgttctc ctgattttct accaaacgat tcaaacgcct cttaaacaaa
     4441 aaagaaactg tgtaattcta tgtgtaaaac gaaaactgct ttaagtgtct gc