Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster kin of irre (kirre), transcript variant A,


LOCUS       NM_166958               3426 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_166958
VERSION     NM_166958.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 3426)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3426)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3426)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 3426)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 3426)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 3426)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 3426)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 3426)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 3426)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 3426)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 3426)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 3426)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 3426)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 3426)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 3426)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 3426)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 3426)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 3426)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On May 8, 2012 this sequence version replaced NM_166958.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3426
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..3426
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="kin of irre"
                     /map="3B4-3C7"
                     /db_xref="FLYBASE:FBgn0028369"
                     /db_xref="GeneID:31292"
     CDS             190..3060
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="CG3653 gene product from transcript CG3653-RA;
                     CG3653-PA; kirre-PA; dumbfounded; Dumbfounded/Kirre; Kin
                     of irregular-chiasm-C; kin-of-irreC; kin of irreC;
                     Kin-of-irre"
                     /codon_start=1
                     /product="kin of irre, isoform A"
                     /protein_id="NP_726844.1"
                     /db_xref="FLYBASE:FBpp0070535"
                     /db_xref="GeneID:31292"
                     /db_xref="FLYBASE:FBgn0028369"
                     /translation="MKRMRSSRLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHH
                     GDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLP
                     CRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQ
                     CQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA
                     EITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR
                     TYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND
                     ELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVE
                     ADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKAVVNG
                     FPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINM
                     SSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPG
                     NIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKS
                     ELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGG
                     DRYNRQCHIKNLKNQQETAYKGSPQANGYAHYFEYALDYSPPGGEGAAVVVGSGGVGK
                     LKNGGMNSATLPHSAAATVNGGGAGNGGGASLPRNQRHEIQQSQQSNGFLGQPLLQNG
                     IDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANGGLKH
                     FVGGAVITTSPVGNVNINGGGGGGSTPSGGGGVGVGVAAGGSVSGSSSNLTASSNTLA
                     ATPLAGGGVGNSGQCAQSPSGQFILSNNGKGHTQKGPLATHV"
     misc_feature    451..735
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    484..498
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409552"
     misc_feature    619..633
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409552"
     misc_feature    661..678
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409552"
     misc_feature    754..1026
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="CD80-like C2-set immunoglobulin domain; Region:
                     C2-set_2; pfam08205"
                     /db_xref="CDD:400489"
     misc_feature    844..858
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409416"
     misc_feature    940..954
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409416"
     misc_feature    982..999
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409416"
     misc_feature    1027..1038
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409416"
     misc_feature    1108..1326
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Immunoglobulin domain; Region: Ig_2; pfam13895"
                     /db_xref="CDD:464026"
     misc_feature    1333..1575
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1384..1398
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1423..1440
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1510..1527
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1552..1563
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1585..1872
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1633..1647
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1675..1689
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1774..1788
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1816..1833
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1855..1866
                     /gene="kirre"
                     /locus_tag="Dmel_CG3653"
                     /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf;
                     Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1;
                     Kirre; Neph1; RH09239"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
ORIGIN      
        1 atagtatttt tttttttaga tgtattcttg gatgtcattt gtttgtttgt ttctttcggt
       61 gcacaaatgc agttacattc acggcttagc ggccgttgca gttgcagtcc gctgcagttg
      121 atgccacaaa tccagacaac tgacaagccc acatatttcg cttcctgagt tagcaatttg
      181 ccgctgaaaa tgaagcgaat gcgcagcagt cgcctcctgg tgctgccatt gatccttgtg
      241 ctgatcctga cgctgctcct ccaaccgatt gccgtccacg ccaaatcgaa gaagaacaag
      301 tccagccaga gctcgcacca cggtgactca tcctcctcct cctcatcctc atcctcgtcg
      361 agtggctcct catcggcggc agcatcgtca gcgaatgatg aaagcaaacc gaagggcggc
      421 gacaatggtg gtcagcactt tgccatggag ccgcaggatc agacggccgt cgttggttca
      481 cgcgtaacgt tgccatgccg ggttatggag aaagttggtg ccctgcaatg gaccaaagat
      541 gacttcggtc tgggccaaca tcgcaatttg agcggcttcg aacgctactc gatggtcggc
      601 agcgatgagg agggtgactt ctcattggac atttatccgc taatgctgga cgacgatgcc
      661 aagtatcagt gtcaagtggg tccaggtcca cagggcgagc agggtattcg ttcgcgattc
      721 gccaagctaa ccgttctcgt tccgcccgag gcgccgaaaa tcacgcaagg tgactatctg
      781 gtgaccaccg aagatcgtga aatcgaattg gagtgcgtgt cgcagggcgg caagcccgca
      841 gccgaaatca cttggattga cggactgggc aatgtcctaa ccaagggtat tgaatatgta
      901 aaggaaccgc tggccgattc gcgtcgaatt acagccagat cgatactgaa attggcgccc
      961 aagaaggagc atcacaacac aacgttcacg tgccaggcgc aaaataccgc cgatcgaacc
     1021 tatagatcgg ccaaactgct gctcgaggtg aaatatgcgc ccaaggtcat cgtttcggtt
     1081 gtgggtggtg cattggctgg tggcaaaatt cccgaaggcg ccgaggtaat actaagctgt
     1141 caggccgacg ccaatccgca tgagctcagc tatcgttggt tcatcaacga tgagctaatg
     1201 accggagact ttaccactaa gatgatcatt cacaatgttt cgaggcaata tcacgatgcc
     1261 atagtcaagt gcgaggtggt taatgcggtg ggcaagagcg aacagagcaa gaaactggac
     1321 attagttttg gtccagtttt tcgccagcgt cccgttagcg tggaagccga tctgggcgcc
     1381 accgttagca tgcgttgcga tgtggctggc aatccggagc ccgaaatcga atggatcagc
     1441 gagaactccg atcaggttgt tggcgttgca gcggaactga aattgaaagt gagcagcgaa
     1501 acggcaggtc gctacttttg caaggctgtg gtcaatggat ttcccgaaat cggtgccgag
     1561 gcaacgctgt acgtgaaaag ggcaccgatt atcacatcgc acaaggtgca atttggcgga
     1621 gttggtggtc gcgttaagat cgattgtttg gcctttagca taccgaaggc ggagcatata
     1681 ctctggtcgt tcgagggcaa gattatcaat atgagcagcg ccgatccgga tatatatata
     1741 ttcgaggagc atcatttgcc ggagggcgtg cgagcggcct tgattattcg cgatagcaag
     1801 gccacacatt ttggcaaata caattgtaca gtgatgaatt cgtatggcgg tgattcgttg
     1861 gttataacat tgctacgcga accgggcaac atacccgttc tgctggtcgt tatgggctcc
     1921 atgttttgcg tggccatcat tctgatgatc gtaatgatta ttatcgtgta ccgcaagcga
     1981 cgcagtcgca agaagcccat gccagcggat gtaataccgg aggcatcacg cggcggtgat
     2041 aagctaaacg aattgaagag cgagctacgc tcgaaggcct atgatgtgga atactcggag
     2101 gcgggcggcg atggactggc cattaatctt acccaatcac cgatgcccga tgttcagatg
     2161 aagggcgcca cacttggtgt gccactagcc ggacccgtta agttcgatga gcgcttttcg
     2221 ggcgatttcg gtggcgatcg ttacaatcga cagtgtcaca ttaagaatct aaagaatcaa
     2281 caggagaccg cctacaaggg tagtccacag gccaatggct atgcccatta ctttgaatat
     2341 gccctcgact atagtccgcc gggcggtgag ggtgctgccg tggtggtggg cagcggcggc
     2401 gttggcaagt tgaagaacgg tggcatgaac tcggccacgt tgccccactc ggcggctgcc
     2461 accgtgaatg ggggcggtgc tggcaatggg ggcggtgcca gtttgccgcg caatcagcgg
     2521 cacgagattc aacagtcgca gcaatcaaac ggatttctcg gacaaccgct gctgcagaat
     2581 ggcatcgata gccgctttag cgccatctat ggtaatccct atttaaggac gaactcctcg
     2641 ctactgccgc ccctgccgcc gccgagcacc gccaatccgg cggccacgcc cgccccgccc
     2701 ccctatcatg ccgctcgcca cggccacgcc catcacgcca acggcggact caagcatttt
     2761 gtgggcggcg ctgtgatcac cacaagtccc gtgggaaatg tgaacattaa tggcggcgga
     2821 ggcggtggct cgacgcccag cggtggcggc ggcgtgggcg tgggcgtggc agctggtggc
     2881 agcgtcagcg gcagcagttc caacttgacc gccagcagca atacactggc ggccacgccc
     2941 ctagcgggcg gcggcgtcgg caacagcggc cagtgcgccc agagtccgtc cggtcagttt
     3001 atattgtcga ataatggcaa aggacacacg cagaaaggac ctctggccac tcatgtttaa
     3061 actacaaaga aggatataca cacacatctt tctatattat atatatatat atagaaggca
     3121 ctagcataac tcataaatgt atttaaaagc cgaacatcta gtgtgtaaac tttttttttt
     3181 tgtccatcga tattagcgta atattctgat tcaagcggtg tgctgaactt tcgaaaagat
     3241 cttgggttgt aaatgcaact gacttggatt tatctgatat ggctgaaatt cgagcactaa
     3301 gaatgtgact gctttcgttt gtaaatttgt aacgtacagc tcccaaaaac aaaaaaaaag
     3361 agaaaagagt tcaacacacc cttgagtaaa aaaaagaaat gtgtataaaa acgaaaaaca
     3421 aaacac