Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_166958 3426 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_166958 VERSION NM_166958.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 3426) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 3426) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 3426) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 3426) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 3426) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 3426) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 3426) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 3426) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 3426) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 3426) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 3426) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 3426) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 3426) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 3426) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 3426) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 3426) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 3426) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 3426) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On May 8, 2012 this sequence version replaced NM_166958.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3426 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..3426 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="kin of irre" /map="3B4-3C7" /db_xref="FLYBASE:FBgn0028369" /db_xref="GeneID:31292" CDS 190..3060 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="CG3653 gene product from transcript CG3653-RA; CG3653-PA; kirre-PA; dumbfounded; Dumbfounded/Kirre; Kin of irregular-chiasm-C; kin-of-irreC; kin of irreC; Kin-of-irre" /codon_start=1 /product="kin of irre, isoform A" /protein_id="NP_726844.1" /db_xref="FLYBASE:FBpp0070535" /db_xref="GeneID:31292" /db_xref="FLYBASE:FBgn0028369" /translation="MKRMRSSRLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHH GDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLP CRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQ CQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA EITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR TYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND ELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVE ADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKAVVNG FPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINM SSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPG NIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKS ELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGG DRYNRQCHIKNLKNQQETAYKGSPQANGYAHYFEYALDYSPPGGEGAAVVVGSGGVGK LKNGGMNSATLPHSAAATVNGGGAGNGGGASLPRNQRHEIQQSQQSNGFLGQPLLQNG IDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANGGLKH FVGGAVITTSPVGNVNINGGGGGGSTPSGGGGVGVGVAAGGSVSGSSSNLTASSNTLA ATPLAGGGVGNSGQCAQSPSGQFILSNNGKGHTQKGPLATHV" misc_feature 451..735 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 484..498 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409552" misc_feature 619..633 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409552" misc_feature 661..678 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409552" misc_feature 754..1026 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="CD80-like C2-set immunoglobulin domain; Region: C2-set_2; pfam08205" /db_xref="CDD:400489" misc_feature 844..858 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409416" misc_feature 940..954 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409416" misc_feature 982..999 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409416" misc_feature 1027..1038 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409416" misc_feature 1108..1326 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig_2; pfam13895" /db_xref="CDD:464026" misc_feature 1333..1575 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1384..1398 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1423..1440 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1510..1527 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1552..1563 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1585..1872 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1633..1647 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1675..1689 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1774..1788 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1816..1833 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1855..1866 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" ORIGIN 1 atagtatttt tttttttaga tgtattcttg gatgtcattt gtttgtttgt ttctttcggt 61 gcacaaatgc agttacattc acggcttagc ggccgttgca gttgcagtcc gctgcagttg 121 atgccacaaa tccagacaac tgacaagccc acatatttcg cttcctgagt tagcaatttg 181 ccgctgaaaa tgaagcgaat gcgcagcagt cgcctcctgg tgctgccatt gatccttgtg 241 ctgatcctga cgctgctcct ccaaccgatt gccgtccacg ccaaatcgaa gaagaacaag 301 tccagccaga gctcgcacca cggtgactca tcctcctcct cctcatcctc atcctcgtcg 361 agtggctcct catcggcggc agcatcgtca gcgaatgatg aaagcaaacc gaagggcggc 421 gacaatggtg gtcagcactt tgccatggag ccgcaggatc agacggccgt cgttggttca 481 cgcgtaacgt tgccatgccg ggttatggag aaagttggtg ccctgcaatg gaccaaagat 541 gacttcggtc tgggccaaca tcgcaatttg agcggcttcg aacgctactc gatggtcggc 601 agcgatgagg agggtgactt ctcattggac atttatccgc taatgctgga cgacgatgcc 661 aagtatcagt gtcaagtggg tccaggtcca cagggcgagc agggtattcg ttcgcgattc 721 gccaagctaa ccgttctcgt tccgcccgag gcgccgaaaa tcacgcaagg tgactatctg 781 gtgaccaccg aagatcgtga aatcgaattg gagtgcgtgt cgcagggcgg caagcccgca 841 gccgaaatca cttggattga cggactgggc aatgtcctaa ccaagggtat tgaatatgta 901 aaggaaccgc tggccgattc gcgtcgaatt acagccagat cgatactgaa attggcgccc 961 aagaaggagc atcacaacac aacgttcacg tgccaggcgc aaaataccgc cgatcgaacc 1021 tatagatcgg ccaaactgct gctcgaggtg aaatatgcgc ccaaggtcat cgtttcggtt 1081 gtgggtggtg cattggctgg tggcaaaatt cccgaaggcg ccgaggtaat actaagctgt 1141 caggccgacg ccaatccgca tgagctcagc tatcgttggt tcatcaacga tgagctaatg 1201 accggagact ttaccactaa gatgatcatt cacaatgttt cgaggcaata tcacgatgcc 1261 atagtcaagt gcgaggtggt taatgcggtg ggcaagagcg aacagagcaa gaaactggac 1321 attagttttg gtccagtttt tcgccagcgt cccgttagcg tggaagccga tctgggcgcc 1381 accgttagca tgcgttgcga tgtggctggc aatccggagc ccgaaatcga atggatcagc 1441 gagaactccg atcaggttgt tggcgttgca gcggaactga aattgaaagt gagcagcgaa 1501 acggcaggtc gctacttttg caaggctgtg gtcaatggat ttcccgaaat cggtgccgag 1561 gcaacgctgt acgtgaaaag ggcaccgatt atcacatcgc acaaggtgca atttggcgga 1621 gttggtggtc gcgttaagat cgattgtttg gcctttagca taccgaaggc ggagcatata 1681 ctctggtcgt tcgagggcaa gattatcaat atgagcagcg ccgatccgga tatatatata 1741 ttcgaggagc atcatttgcc ggagggcgtg cgagcggcct tgattattcg cgatagcaag 1801 gccacacatt ttggcaaata caattgtaca gtgatgaatt cgtatggcgg tgattcgttg 1861 gttataacat tgctacgcga accgggcaac atacccgttc tgctggtcgt tatgggctcc 1921 atgttttgcg tggccatcat tctgatgatc gtaatgatta ttatcgtgta ccgcaagcga 1981 cgcagtcgca agaagcccat gccagcggat gtaataccgg aggcatcacg cggcggtgat 2041 aagctaaacg aattgaagag cgagctacgc tcgaaggcct atgatgtgga atactcggag 2101 gcgggcggcg atggactggc cattaatctt acccaatcac cgatgcccga tgttcagatg 2161 aagggcgcca cacttggtgt gccactagcc ggacccgtta agttcgatga gcgcttttcg 2221 ggcgatttcg gtggcgatcg ttacaatcga cagtgtcaca ttaagaatct aaagaatcaa 2281 caggagaccg cctacaaggg tagtccacag gccaatggct atgcccatta ctttgaatat 2341 gccctcgact atagtccgcc gggcggtgag ggtgctgccg tggtggtggg cagcggcggc 2401 gttggcaagt tgaagaacgg tggcatgaac tcggccacgt tgccccactc ggcggctgcc 2461 accgtgaatg ggggcggtgc tggcaatggg ggcggtgcca gtttgccgcg caatcagcgg 2521 cacgagattc aacagtcgca gcaatcaaac ggatttctcg gacaaccgct gctgcagaat 2581 ggcatcgata gccgctttag cgccatctat ggtaatccct atttaaggac gaactcctcg 2641 ctactgccgc ccctgccgcc gccgagcacc gccaatccgg cggccacgcc cgccccgccc 2701 ccctatcatg ccgctcgcca cggccacgcc catcacgcca acggcggact caagcatttt 2761 gtgggcggcg ctgtgatcac cacaagtccc gtgggaaatg tgaacattaa tggcggcgga 2821 ggcggtggct cgacgcccag cggtggcggc ggcgtgggcg tgggcgtggc agctggtggc 2881 agcgtcagcg gcagcagttc caacttgacc gccagcagca atacactggc ggccacgccc 2941 ctagcgggcg gcggcgtcgg caacagcggc cagtgcgccc agagtccgtc cggtcagttt 3001 atattgtcga ataatggcaa aggacacacg cagaaaggac ctctggccac tcatgtttaa 3061 actacaaaga aggatataca cacacatctt tctatattat atatatatat atagaaggca 3121 ctagcataac tcataaatgt atttaaaagc cgaacatcta gtgtgtaaac tttttttttt 3181 tgtccatcga tattagcgta atattctgat tcaagcggtg tgctgaactt tcgaaaagat 3241 cttgggttgt aaatgcaact gacttggatt tatctgatat ggctgaaatt cgagcactaa 3301 gaatgtgact gctttcgttt gtaaatttgt aacgtacagc tcccaaaaac aaaaaaaaag 3361 agaaaagagt tcaacacacc cttgagtaaa aaaaagaaat gtgtataaaa acgaaaaaca 3421 aaacac