Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster armadillo (arm), transcript variant C,


LOCUS       NM_166912               3123 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_166912
VERSION     NM_166912.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 3123)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3123)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3123)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 3123)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 3123)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 3123)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 3123)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 3123)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 3123)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 3123)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 3123)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 3123)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 3123)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 3123)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 3123)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 3123)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 3123)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 3123)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Mar 18, 2004 this sequence version replaced NM_166912.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3123
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..3123
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo"
                     /map="2B14-2B14"
                     /db_xref="FLYBASE:FBgn0000117"
                     /db_xref="GeneID:31151"
     CDS             260..2425
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="CG11579 gene product from transcript CG11579-RC;
                     CG11579-PC; arm-PC; amardillo; betaCatenin;
                     Beta-catenin/Arm; Armadillo/beta-catenin; beta-Catenin;
                     alpha-Catenin; beta-catenin/Armadillo;
                     Armadillo/bgr;-catenin; armadillo; b-catenin;
                     Armadillo(Arm)/beta-catenin"
                     /codon_start=1
                     /product="armadillo, isoform C"
                     /protein_id="NP_726775.2"
                     /db_xref="FLYBASE:FBpp0089033"
                     /db_xref="GeneID:31151"
                     /db_xref="FLYBASE:FBgn0000117"
                     /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS
                     GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT
                     LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMILYQ"
     misc_feature    512..736
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(530..541,551..556,560..568,575..580,587..589,
                     641..649,653..658,665..670,677..679,686..712)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <707..>1171
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    740..817
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    836..952
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    971..1069
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1040..1042,1052..1054,1064..1066,1166..1168,
                     1178..1180,1190..1192,1295..1297,1307..1309,1319..1321)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1091..1201
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1217..1324
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1340..1453
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1343..1450
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1487..1564
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1535..1537,1547..1549,1559..1561,1667..1669,
                     1679..1681,1691..1693,1805..1807,1817..1819,1829..1831)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1574..1702
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1586..1702
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1727..1834
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(2009..2011,2021..2023,2033..2035,2132..2134,
                     2144..2146,2156..2158,2255..2257,2267..2269,2279..2281)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    2048..2167
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    2057..2167
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2180..2284
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
ORIGIN      
        1 ctcccagtct ctttccctgt ccctttcccg cactccgcac gcgcggtgtt gcaagtgcct
       61 tgctttgctt gcgctctccg catctggatt ctgttccgtt taaacgagcg tgctggtcgg
      121 tcgcattttc cgctgcgcct ttttcgagag aagtgaaaaa tccattttgt tttttgttgg
      181 agtgcatgag atttgaaaga gtgctaaaca aagtaattaa ataactcaag gtgtggtgta
      241 aagcgcctca atcaccaaga tgagttacat gccagcccag aatcgaacca tgtcgcataa
      301 taatcaatac aatccacctg atctgccgcc gatggtatcc gccaaggagc agaccctcat
      361 gtggcagcag aattcgtact tgggcgactc cggcatccac tcgggtgccg tgacccaggt
      421 tccatcgctg tctggcaagg aggacgagga gatggaggga gatccactta tgttcgacct
      481 ggacaccggt ttcccgcaga atttcacaca agaccaagtg gacgatatga accagcaact
      541 gagccagaca cgctcccaac gtgtacgtgc tgccatgttt ccggaaaccc tggaggaggg
      601 cattgagatt ccctccaccc agtttgatcc ccaacagccg acggcagtgc aacgtctttc
      661 ggaaccgtca caaatgctaa agcacgcggt ggtcaatctg atcaactacc aggacgacgc
      721 tgagctggca accagggcca tacccgagtt gatcaagctg ctgaacgatg aggatcaggt
      781 ggtagtttcc caggccgcca tgatggtcca ccagctgtct aagaaggagg cctcgcgaca
      841 tgccattatg aacagccctc agatggtagc cgctttggtg cgtgccatct ctaacagcaa
      901 cgatctggag agcaccaagg cagcggtagg aacactgcac aacttatcac accatcgcca
      961 gggtctgctg gccatcttca agagtggcgg catcccggca ctcgtcaagt tgctctcctc
     1021 gccagtggag agtgtgctgt tctatgcaat taccactctg cacaatttgc tgctccacca
     1081 ggatggctct aagatggctg tgcgcctggc cggcgggctt cagaagatgg ttactctgct
     1141 gcaacgaaac aacgttaagt ttctggctat cgtcacagat tgcttgcaaa ttctggccta
     1201 tggtaaccag gagagcaagt taataattct tgcctccgga gggcccaacg aactcgtgcg
     1261 cattatgcgc tcctacgact acgagaagct tctgtggacc acttcgcggg tactgaaagt
     1321 gctctccgtt tgctccagca acaagccggc catcgtggat gccggtggaa tgcaggcgct
     1381 ggctatgcac ttgggtaaca tgtcaccgcg ccttgtgcaa aactgtttgt ggacgctccg
     1441 caatctttcg gatgcagcca ctaaggtgga gggccttgaa gctttgctcc aatctctcgt
     1501 ccaggttctg ggctcgaccg atgtcaacgt ggtcacctgt gccgccggta tcctttcaaa
     1561 tctgacgtgc aacaatcagc gcaacaaggc caccgtttgt caggtgggcg gtgtggacgc
     1621 cctcgtccgt actattatca atgctggaga tcgcgaagag attaccgagc cggctgtatg
     1681 tgccctgcgt cacttgacct cgcgtcatgt ggactctgag ttggcccaga atgccgtacg
     1741 cttaaactac ggactatcgg tgattgtaaa gctattgcat ccaccatcac gctggccctt
     1801 gatcaaggcc gtcattggac tcatacgcaa tttggccctc tgtccggcca atcacgcccc
     1861 gttgcgggag cacggggcca tccaccatct ggtgcgactg cttatgcgcg ccttccaaga
     1921 cacagagagg caacgttcct cgatagccac cactggttca cagcagccgt ccgcatacgc
     1981 tgacggcgtt cgcatggagg agattgtcga gggcacggtg ggggcgctac atatcctggc
     2041 ccgcgagtct cacaaccggg cactcattcg ccagcagtcg gtaataccga tctttgtacg
     2101 attgctgttc aacgaaatcg agaacataca gcgcgtggct gctggcgttc tttgtgagct
     2161 cgccgctgac aaggagggcg ccgagattat cgagcaggag ggcgccactg ggccgctgac
     2221 cgatctcctg cactcgcgca atgaaggcgt ggccacatac gccgccgctg ttctctttcg
     2281 catgagtgag gacaagccgc aggattacaa gaagcggcta tccatagagc tgaccaactc
     2341 gctgctgcgc gaggacaaca acatatgggc caatgccgac ctgggcatgg gtcccgatct
     2401 acaggatatg atactctacc aatagattcg atgcagggtc tggagatcag cagcccagtg
     2461 ggcggcggcg gtgctggcgg tgctcccggc aatggtggag ctgtaggcgg agctagcggc
     2521 ggcggtggta acatcggcgc cattccgcct agcggcgcac caacttcgcc ctattccatg
     2581 gacatggacg ttggcgagat tgatgccggt gcattgaact ttgacttgga cgccatgccg
     2641 acgccaccca atgacaacaa caacctggct gcctggtacg ataccgattg ttagacaagc
     2701 cgagctaagg gtaagggtcg agtatccatt cgaccccata acataaaaca cacgaattcc
     2761 catccctgca caatagccct cttccaccgg ctttgattcc atcccggatc ccggaatcgc
     2821 gatcaccgaa acttgactag atcaacgaag gtgtggattt tacttgacaa atacgaggag
     2881 ctgcggcagg tcaaagttct gcttccagaa ctgaagtccg tgggagaagg ctatttgctc
     2941 acacaccata ccccgcgaca aagcatacac acacgcatac atgcataata ttatacattt
     3001 attataatgc gaacgaaacg gcaagaaaaa catattatat gatgcattac atattaccca
     3061 cgtaaacgaa atggaaaatt aaacaaatgt ttgcaataga actcgtacat ttcccttcat
     3121 atg