Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_134273 3220 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_134273 VERSION NM_134273.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 3220) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 3220) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 3220) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 3220) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 3220) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 3220) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 3220) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 3220) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 3220) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 3220) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 3220) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 3220) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 3220) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 3220) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 3220) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 3220) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 3220) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 3220) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Nov 6, 2002 this sequence version replaced NM_134273.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3220 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..3220 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo" /map="2B14-2B14" /db_xref="FLYBASE:FBgn0000117" /db_xref="GeneID:31151" CDS 260..2791 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="CG11579 gene product from transcript CG11579-RB; CG11579-PB; arm-PB; amardillo; betaCatenin; Beta-catenin/Arm; Armadillo/beta-catenin; beta-Catenin; alpha-Catenin; beta-catenin/Armadillo; Armadillo/bgr;-catenin; armadillo; b-catenin; Armadillo(Arm)/beta-catenin" /codon_start=1 /product="armadillo, isoform B" /protein_id="NP_599100.1" /db_xref="FLYBASE:FBpp0089032" /db_xref="GeneID:31151" /db_xref="FLYBASE:FBgn0000117" /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGAVGGASGGGGNIGAIPPSG APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC" misc_feature 512..736 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="alpha-catenin binding domain found in Drosophila melanogaster armadillo segment polarity protein (dArm) and similar proteins; Region: CTNNAbd_dArm; cd21726" /db_xref="CDD:439243" misc_feature order(530..541,551..556,560..568,575..580,587..589, 641..649,653..658,665..670,677..679,686..712) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative CNTTA binding site [polypeptide binding]; other site" /db_xref="CDD:439243" misc_feature <707..>1201 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Adaptin N terminal region; Region: Adaptin_N; pfam01602" /db_xref="CDD:396262" misc_feature 740..817 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 836..952 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 971..1069 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(1040..1042,1052..1054,1064..1066,1166..1168, 1178..1180,1190..1192,1295..1297,1307..1309,1319..1321) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 1091..1201 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1217..1324 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1340..1453 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 1343..1450 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1487..1564 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(1535..1537,1547..1549,1559..1561,1667..1669, 1679..1681,1691..1693,1805..1807,1817..1819,1829..1831) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 1574..1702 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 1586..1702 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1727..1834 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(2009..2011,2021..2023,2033..2035,2132..2134, 2144..2146,2156..2158,2255..2257,2267..2269,2279..2281) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 2048..2167 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 2057..2167 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 2180..2284 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" ORIGIN 1 ctcccagtct ctttccctgt ccctttcccg cactccgcac gcgcggtgtt gcaagtgcct 61 tgctttgctt gcgctctccg catctggatt ctgttccgtt taaacgagcg tgctggtcgg 121 tcgcattttc cgctgcgcct ttttcgagag aagtgaaaaa tccattttgt tttttgttgg 181 agtgcatgag atttgaaaga gtgctaaaca aagtaattaa ataactcaag gtgtggtgta 241 aagcgcctca atcaccaaga tgagttacat gccagcccag aatcgaacca tgtcgcataa 301 taatcaatac aatccacctg atctgccgcc gatggtatcc gccaaggagc agaccctcat 361 gtggcagcag aattcgtact tgggcgactc cggcatccac tcgggtgccg tgacccaggt 421 tccatcgctg tctggcaagg aggacgagga gatggaggga gatccactta tgttcgacct 481 ggacaccggt ttcccgcaga atttcacaca agaccaagtg gacgatatga accagcaact 541 gagccagaca cgctcccaac gtgtacgtgc tgccatgttt ccggaaaccc tggaggaggg 601 cattgagatt ccctccaccc agtttgatcc ccaacagccg acggcagtgc aacgtctttc 661 ggaaccgtca caaatgctaa agcacgcggt ggtcaatctg atcaactacc aggacgacgc 721 tgagctggca accagggcca tacccgagtt gatcaagctg ctgaacgatg aggatcaggt 781 ggtagtttcc caggccgcca tgatggtcca ccagctgtct aagaaggagg cctcgcgaca 841 tgccattatg aacagccctc agatggtagc cgctttggtg cgtgccatct ctaacagcaa 901 cgatctggag agcaccaagg cagcggtagg aacactgcac aacttatcac accatcgcca 961 gggtctgctg gccatcttca agagtggcgg catcccggca ctcgtcaagt tgctctcctc 1021 gccagtggag agtgtgctgt tctatgcaat taccactctg cacaatttgc tgctccacca 1081 ggatggctct aagatggctg tgcgcctggc cggcgggctt cagaagatgg ttactctgct 1141 gcaacgaaac aacgttaagt ttctggctat cgtcacagat tgcttgcaaa ttctggccta 1201 tggtaaccag gagagcaagt taataattct tgcctccgga gggcccaacg aactcgtgcg 1261 cattatgcgc tcctacgact acgagaagct tctgtggacc acttcgcggg tactgaaagt 1321 gctctccgtt tgctccagca acaagccggc catcgtggat gccggtggaa tgcaggcgct 1381 ggctatgcac ttgggtaaca tgtcaccgcg ccttgtgcaa aactgtttgt ggacgctccg 1441 caatctttcg gatgcagcca ctaaggtgga gggccttgaa gctttgctcc aatctctcgt 1501 ccaggttctg ggctcgaccg atgtcaacgt ggtcacctgt gccgccggta tcctttcaaa 1561 tctgacgtgc aacaatcagc gcaacaaggc caccgtttgt caggtgggcg gtgtggacgc 1621 cctcgtccgt actattatca atgctggaga tcgcgaagag attaccgagc cggctgtatg 1681 tgccctgcgt cacttgacct cgcgtcatgt ggactctgag ttggcccaga atgccgtacg 1741 cttaaactac ggactatcgg tgattgtaaa gctattgcat ccaccatcac gctggccctt 1801 gatcaaggcc gtcattggac tcatacgcaa tttggccctc tgtccggcca atcacgcccc 1861 gttgcgggag cacggggcca tccaccatct ggtgcgactg cttatgcgcg ccttccaaga 1921 cacagagagg caacgttcct cgatagccac cactggttca cagcagccgt ccgcatacgc 1981 tgacggcgtt cgcatggagg agattgtcga gggcacggtg ggggcgctac atatcctggc 2041 ccgcgagtct cacaaccggg cactcattcg ccagcagtcg gtaataccga tctttgtacg 2101 attgctgttc aacgaaatcg agaacataca gcgcgtggct gctggcgttc tttgtgagct 2161 cgccgctgac aaggagggcg ccgagattat cgagcaggag ggcgccactg ggccgctgac 2221 cgatctcctg cactcgcgca atgaaggcgt ggccacatac gccgccgctg ttctctttcg 2281 catgagtgag gacaagccgc aggattacaa gaagcggcta tccatagagc tgaccaactc 2341 gctgctgcgc gaggacaaca acatatgggc caatgccgac ctgggcatgg gtcccgatct 2401 acaggatatg cttggaccag aagaagcata tgagggcctg tacggacaag gtccgcccag 2461 cgtgcacagt tcacacggag gtcgcgcatt ccatcagcaa ggatatgata ctctaccaat 2521 agattcgatg cagggtctgg agatcagcag cccagtgggc ggcggcggtg ctggcggtgc 2581 tcccggcaat ggtggagctg taggcggagc tagcggcggc ggtggtaaca tcggcgccat 2641 tccgcctagc ggcgcaccaa cttcgcccta ttccatggac atggacgttg gcgagattga 2701 tgccggtgca ttgaactttg acttggacgc catgccgacg ccacccaatg acaacaacaa 2761 cctggctgcc tggtacgata ccgattgtta gacaagccga gctaagggta agggtcgagt 2821 atccattcga ccccataaca taaaacacac gaattcccat ccctgcacaa tagccctctt 2881 ccaccggctt tgattccatc ccggatcccg gaatcgcgat caccgaaact tgactagatc 2941 aacgaaggtg tggattttac ttgacaaata cgaggagctg cggcaggtca aagttctgct 3001 tccagaactg aagtccgtgg gagaaggcta tttgctcaca caccataccc cgcgacaaag 3061 catacacaca cgcatacatg cataatatta tacatttatt ataatgcgaa cgaaacggca 3121 agaaaaacat attatatgat gcattacata ttacccacgt aaacgaaatg gaaaattaaa 3181 caaatgtttg caatagaact cgtacatttc ccttcatatg