Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_132572 1588 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_132572 VERSION NM_132572.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1588) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1588) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1588) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1588) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1588) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1588) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1588) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1588) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1588) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1588) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1588) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1588) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1588) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1588) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1588) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1588) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1588) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1588) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_132572.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1588 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1588 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /map="11A11-11A11" /db_xref="FLYBASE:FBgn0030391" /db_xref="GeneID:32195" CDS 251..1018 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="CG1900 gene product from transcript CG1900-RA; CG1900-PA; Rab40-PA" /codon_start=1 /product="Rab40, isoform A" /protein_id="NP_572800.2" /db_xref="FLYBASE:FBpp0073501" /db_xref="GeneID:32195" /db_xref="FLYBASE:FBgn0030391" /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN AYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDR WLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRE SFCELARMALHRNGMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLK SYALTTSQCFNSLTQSSKSKNRCKTPTSSSRNSCAIA" misc_feature 266..1015 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c; Region: Rab40; cd04121" /db_xref="CDD:133321" misc_feature 284..289 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:133321" misc_feature 302..325 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G1 box; other site" /db_xref="CDD:133321" misc_feature order(308..328,356..358,371..373,449..451,611..616, 620..622,701..709) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133321" misc_feature 326..358 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:133321" misc_feature order(356..358,371..391) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Switch I region; other site" /db_xref="CDD:133321" misc_feature 371..373 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G2 box; other site" /db_xref="CDD:133321" misc_feature order(374..376,380..388,431..433,437..439,458..463, 470..472,482..484,497..499) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative effector interaction site [active]" /db_xref="CDD:133321" misc_feature order(374..379,383..385,437..442,461..463,467..469, 473..481) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:133321" misc_feature 374..388 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:133321" misc_feature order(377..400,419..421,425..427) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133321" misc_feature 425..439 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:133321" misc_feature 440..451 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G3 box; other site" /db_xref="CDD:133321" misc_feature order(449..451,455..487) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Switch II region; other site" /db_xref="CDD:133321" misc_feature 458..475 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:133321" misc_feature 482..496 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:133321" misc_feature 509..526 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:133321" misc_feature 578..604 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:133321" misc_feature 611..622 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G4 box; other site" /db_xref="CDD:133321" misc_feature 701..709 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G5 box; other site" /db_xref="CDD:133321" misc_feature 749..769 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:133321" misc_feature 794..922 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins...; Region: SOCS; cl02533" /db_xref="CDD:470605" misc_feature order(797..814,830..832,851..853,869..871) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="elongin B/C interaction [active]" /db_xref="CDD:239641" misc_feature 1004..1015 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative lipid modification site [posttranslational modification]; other site" /db_xref="CDD:133321" ORIGIN 1 tagcagttct tccatcccta tagagatgag cgaaattgca attttctgtt ttaatattcg 61 cagcagaaaa aacaacaaat aaacagcaat aaattggaat atatgggata tatagccgcg 121 atttaacttg cttaaatcgt aagactgaaa aagcgtgtaa agcccgccga ggtgaagtcg 181 ccaaagcgag gaaactcgct catctctatt acaaatacga aaatgaaact gcgtgcattc 241 taaatgccac atgggaacca tgaccaagga ctacgactat ctgctaaagg ttctactggt 301 gggcgacagc gatgtgggca agcacgagat tctctcaaac ctggaggatc cctccacgga 361 gagtcccttc tgcagtggga acgcctacaa gacgaccacc atcctgctgg agggcaagcg 421 ggtgaagctg cagctgtggg acacctccgg ccagggacgc ttctgcacga tcattcgctc 481 ctattcgcgc ggcgcccagg gcatcatcct cgtctacgac atcaccaaca agtggagctt 541 cgacggtatc gatcggtggc tcaaggaggt cgacgagcac gccccaggaa ttccgaaggt 601 tcttgtcggg aatcgcctgc acttggcctt caagcgacag gtggcggcca aacaggccga 661 gacctacgcc agccgcaaca atatgtcctg cttcgagata tcgcctctct gcaacttcaa 721 catccgcgag tccttttgcg aactggcgcg gatggccctg catcgcaacg gcatggagca 781 catctggcgc agcaataagg tgctgtcgct tcaggaattg tgctgcagga caattgtgcg 841 aaggacgagc gtgtatgcga tcgattcgct gccgctgccg ccgtcggtga agtcgacgct 901 caagtcatac gcgctgacca cgtcccagtg cttcaattca ctgacccaga gctccaagag 961 caagaaccgc tgcaagacgc cgacgagcag cagtcggaat agctgtgcga tcgcgtgatc 1021 gttgccttgt aggccgccgc ccagccgcct acgccgccac gcccctaacc gacattaact 1081 ttaattgagc tctacttatg tactctaggc tataacacac acacacacac acacacccat 1141 accataccca tacccattac catacacaca ttcaacccag ctctttggtt atatgttttg 1201 ttttattgac attgatattt gtggtcaaca atgtttactt tttacacagt aaagcatgca 1261 ccttttttag tttttaacca cccccatccc aggcccattc ccccaacttc tctattttgc 1321 attaatctaa tgttgttaat attattatgt ttgtataatt ctaatattta atgcatcaaa 1381 cacatcaaca tataagaaat gaaaaacaaa aacgaagaaa taacatcaag tgaaaatcaa 1441 cttttatatg gataaaaaga attaaatttt ttttttgttt gtttaccatt cggattaaaa 1501 tattcttaga tatgtattgt aattgaagcg aattcagcaa gagaagcaca cacaaaggcg 1561 aattgataaa aataattcat aatgaact