Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster Rab40, transcript variant A (Rab40), mRNA.


LOCUS       NM_132572               1588 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_132572
VERSION     NM_132572.3
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 1588)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1588)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1588)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 1588)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 1588)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 1588)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 1588)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 1588)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 1588)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 1588)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 1588)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 1588)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 1588)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 1588)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 1588)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 1588)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 1588)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 1588)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_132572.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1588
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..1588
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /map="11A11-11A11"
                     /db_xref="FLYBASE:FBgn0030391"
                     /db_xref="GeneID:32195"
     CDS             251..1018
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="CG1900 gene product from transcript CG1900-RA;
                     CG1900-PA; Rab40-PA"
                     /codon_start=1
                     /product="Rab40, isoform A"
                     /protein_id="NP_572800.2"
                     /db_xref="FLYBASE:FBpp0073501"
                     /db_xref="GeneID:32195"
                     /db_xref="FLYBASE:FBgn0030391"
                     /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN
                     AYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDR
                     WLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRE
                     SFCELARMALHRNGMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLK
                     SYALTTSQCFNSLTQSSKSKNRCKTPTSSSRNSCAIA"
     misc_feature    266..1015
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab GTPase family 40 (Rab40) contains Rab40a,
                     Rab40b and Rab40c; Region: Rab40; cd04121"
                     /db_xref="CDD:133321"
     misc_feature    284..289
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:133321"
     misc_feature    302..325
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="G1 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    order(308..328,356..358,371..373,449..451,611..616,
                     620..622,701..709)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133321"
     misc_feature    326..358
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:133321"
     misc_feature    order(356..358,371..391)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133321"
     misc_feature    371..373
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="G2 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    order(374..376,380..388,431..433,437..439,458..463,
                     470..472,482..484,497..499)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133321"
     misc_feature    order(374..379,383..385,437..442,461..463,467..469,
                     473..481)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133321"
     misc_feature    374..388
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:133321"
     misc_feature    order(377..400,419..421,425..427)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133321"
     misc_feature    425..439
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:133321"
     misc_feature    440..451
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="G3 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    order(449..451,455..487)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133321"
     misc_feature    458..475
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:133321"
     misc_feature    482..496
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:133321"
     misc_feature    509..526
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:133321"
     misc_feature    578..604
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:133321"
     misc_feature    611..622
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="G4 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    701..709
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="G5 box; other site"
                     /db_xref="CDD:133321"
     misc_feature    749..769
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:133321"
     misc_feature    794..922
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="SOCS (suppressors of cytokine signaling) box. The
                     SOCS box is found in the C-terminal region of CIS/SOCS
                     family proteins (in combination with a SH2 domain), ASBs
                     (ankyrin repeat-containing proteins with a SOCS box), SSBs
                     (SPRY domain-containing proteins...; Region: SOCS;
                     cl02533"
                     /db_xref="CDD:470605"
     misc_feature    order(797..814,830..832,851..853,869..871)
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="elongin B/C interaction [active]"
                     /db_xref="CDD:239641"
     misc_feature    1004..1015
                     /gene="Rab40"
                     /locus_tag="Dmel_CG1900"
                     /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40;
                     Q8IR80; rab40"
                     /note="putative lipid modification site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133321"
ORIGIN      
        1 tagcagttct tccatcccta tagagatgag cgaaattgca attttctgtt ttaatattcg
       61 cagcagaaaa aacaacaaat aaacagcaat aaattggaat atatgggata tatagccgcg
      121 atttaacttg cttaaatcgt aagactgaaa aagcgtgtaa agcccgccga ggtgaagtcg
      181 ccaaagcgag gaaactcgct catctctatt acaaatacga aaatgaaact gcgtgcattc
      241 taaatgccac atgggaacca tgaccaagga ctacgactat ctgctaaagg ttctactggt
      301 gggcgacagc gatgtgggca agcacgagat tctctcaaac ctggaggatc cctccacgga
      361 gagtcccttc tgcagtggga acgcctacaa gacgaccacc atcctgctgg agggcaagcg
      421 ggtgaagctg cagctgtggg acacctccgg ccagggacgc ttctgcacga tcattcgctc
      481 ctattcgcgc ggcgcccagg gcatcatcct cgtctacgac atcaccaaca agtggagctt
      541 cgacggtatc gatcggtggc tcaaggaggt cgacgagcac gccccaggaa ttccgaaggt
      601 tcttgtcggg aatcgcctgc acttggcctt caagcgacag gtggcggcca aacaggccga
      661 gacctacgcc agccgcaaca atatgtcctg cttcgagata tcgcctctct gcaacttcaa
      721 catccgcgag tccttttgcg aactggcgcg gatggccctg catcgcaacg gcatggagca
      781 catctggcgc agcaataagg tgctgtcgct tcaggaattg tgctgcagga caattgtgcg
      841 aaggacgagc gtgtatgcga tcgattcgct gccgctgccg ccgtcggtga agtcgacgct
      901 caagtcatac gcgctgacca cgtcccagtg cttcaattca ctgacccaga gctccaagag
      961 caagaaccgc tgcaagacgc cgacgagcag cagtcggaat agctgtgcga tcgcgtgatc
     1021 gttgccttgt aggccgccgc ccagccgcct acgccgccac gcccctaacc gacattaact
     1081 ttaattgagc tctacttatg tactctaggc tataacacac acacacacac acacacccat
     1141 accataccca tacccattac catacacaca ttcaacccag ctctttggtt atatgttttg
     1201 ttttattgac attgatattt gtggtcaaca atgtttactt tttacacagt aaagcatgca
     1261 ccttttttag tttttaacca cccccatccc aggcccattc ccccaacttc tctattttgc
     1321 attaatctaa tgttgttaat attattatgt ttgtataatt ctaatattta atgcatcaaa
     1381 cacatcaaca tataagaaat gaaaaacaaa aacgaagaaa taacatcaag tgaaaatcaa
     1441 cttttatatg gataaaaaga attaaatttt ttttttgttt gtttaccatt cggattaaaa
     1501 tattcttaga tatgtattgt aattgaagcg aattcagcaa gagaagcaca cacaaaggcg
     1561 aattgataaa aataattcat aatgaact