Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_132404 2173 bp mRNA linear INV 26-DEC-2023 A (CG2889), mRNA. ACCESSION NM_132404 VERSION NM_132404.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 2173) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2173) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2173) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 2173) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 2173) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 2173) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 2173) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 2173) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 2173) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 2173) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 2173) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 2173) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 2173) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 2173) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 2173) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 2173) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 2173) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 2173) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On May 8, 2012 this sequence version replaced NM_132404.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2173 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..2173 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /map="9D1-9D1" /db_xref="FLYBASE:FBgn0030206" /db_xref="GeneID:31977" CDS 378..2123 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="CG2889 gene product from transcript CG2889-RA; CG2889-PA" /codon_start=1 /product="uncharacterized protein, isoform A" /protein_id="NP_572632.1" /db_xref="FLYBASE:FBpp0071385" /db_xref="GeneID:31977" /db_xref="FLYBASE:FBgn0030206" /translation="MICRLCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILP DDGISTSVCTECCEHLEDFNGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVN IDELPLAAGDMDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQ ASDSEPEVTEGQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELADL LDDGGKRRRRKAPDQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSASC DLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTIC KKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTDQLE HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAP AVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLTTNL QCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLRA KMARSHNPQFKPADV" misc_feature 381..614 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zinc-finger associated domain (zf-AD); Region: zf-AD; smart00868" /db_xref="CDD:214871" misc_feature <1017..>1247 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="BNR repeat-like domain; Region: BNR_2; pfam13088" /db_xref="CDD:463781" misc_feature 1203..1268 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1203..1205,1212..1214,1251..1253,1266..1268) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1278..>1436 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="N-terminal domain of Oryza sativa transcription factor SUPPRESSOR OF FRI 4 (OsSUF4), Arabidopsis thaliana SUF4 (AtSUF4), and similar proteins; Region: SUF4-like; cd20908" /db_xref="CDD:411020" misc_feature 1278..1346 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 1293..1346 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1299..1301,1305..1307,1311..1313,1317..1322, 1329..1334,1341..1343,1383..1385,1389..1391,1401..1406, 1413..1418,1428..1430,1488..1490,1494..1496,1500..1502, 1506..1511,1518..1523,1530..1532) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature order(1299..1301,1317..1319,1338..1340,1341..1343, 1365..1367,1386..1388) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:411020" misc_feature 1368..1433 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 1368..1433 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1473..1535 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1560..1625 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1560..1562,1569..1571,1608..1610,1623..1625) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1647..1709 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1647..1649,1656..1658,1695..1697,1707..1709) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1818..1883 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1818..1820,1827..1829,1866..1868,1881..1883) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature order(1833..1835,1839..1841,1845..1847,1851..1856, 1863..1868,1878..1880,1920..1922,1926..1928,1938..1943, 1950..1955,1962..1964,2004..2006,2010..2012,2016..2018, 2022..2027,2034..2039) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 1905..1967 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1989..2045 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 ctacaaacaa aatcacagat ttacaaaccc gctgtgcaat taaacataat ttagcaaaca 61 aatctcggtt ccggcctact tccagagcga gagcatgaga gaccatagag cttacccttt 121 cgcacgcaga gcacacaccg caaacacacg tattttgcag acaattaaaa acgtagacca 181 taaattgtaa gagaaattaa agagaaatac tcaacgatca gggtggccac cccgcaaaaa 241 actcctgaga tgaagttttg ccattcacaa ttggattctg ttatcgattc acgataggtg 301 aattatgttg tttacaacga aaaactgttt aaatttttta tttatttgac tttgcgttgt 361 ggttctgttc gcgcgaaatg atttgtcgcc tttgcctgcg atgtcttagt cccggaagcg 421 ctgtcttcct ctttgagacg gacgatacgc ttgcggagac gcgcctggtc aagatgattg 481 cgaagtttct gcagctggag atcctaccag acgacggcat ctcgaccagc gtctgtaccg 541 agtgctgtga gcatctggag gacttcaatg gcttctggca gctggtggag cagaagcagt 601 gctcactcaa gaaggagttc cttaccgtgg acgtcgactg tgcggccatg aagtggacgg 661 gcggtgtgga cgtggacgtc aacatcgacg aactgccgct ggcggctggc gacatggacg 721 agaaaccgtt ggacctgcac aaccttagtc tgctgggaag cgtgctggac gtgaatgtgg 781 acagtgtgga agtcagggaa ccgatcaagg agcagctgcc ctgcgaggag gaggaggacg 841 agaagccctg cctgcaagct agtgatagcg aaccggaggt gaccgagggg cagccggaat 901 ctgaatctga ctcctcagat gatgaacccc tggtccgtct gaaatcgaaa atgaagccca 961 agcgcaaaac ctcggcacgt tcctccaagg atcagggtcc gatatcgctg cagcaggagc 1021 ttgcagatct gctcgacgat ggtggcaagc gtcggcgcag gaaggcacct gaccagcgaa 1081 caaccaccga gtcgcaggag tccgagctac aggccgttct cgagcgcaag cccaagggct 1141 gctcccgtgc tcagctggcc aagagctacg agaaggccat tgctagctac atgagtgcaa 1201 gctgcgacct gtgcgaattt agtgctccct acctatccga attgaagacc cacttcctgg 1261 aggtgcacca gcgcgagtac tacatcaagt gctgcggcaa agtctttaca cgcgcttcca 1321 agctgatgga ccacatccgc aaacatatca accccaagct atttacctgc accatttgca 1381 agaagtcgct caactcgcag gactacttgg ccactcatat cgagacggtg cacaacaagg 1441 tggctcaaat cggcaaggtg ctcaagttcc cgtgccccaa gtgcgaacgc accttcagca 1501 gcgagcgccg tatggccaat catctggcca agcacgacac cgatcaactg gagcacacct 1561 gcgagatctg ctgcaaaagc tttgccaatg tacaccgcct gcgaaggcac atccaatcca 1621 tccacgaaga cctgcatcgt cacgtttgcg acatttgcgg gaagaagttc aagttcaagc 1681 cctccttcga gcgccatttg ctggagcacc agggcgtcgt ggccccggct gtggagtgcc 1741 ccatctgccg tgtttggctg aagaacgagc acagcttgcg cctgcaccgc ttcacacacg 1801 acagcacgga caccgtgtgt ccgcattgtg gcaagacctg cacatcgcgc acagcgctcc 1861 gcggtcacgt caaatatgcc cacaagctga ccaccaatct gcagtgcacg ttctgcgaga 1921 aaaccttcaa gcagcagcgc aacctggacg agcacatggc catccacacg ggcctgcagc 1981 tgtacaactg tccgcattgc cccaaggagt gccgttcccg ctccaatatg tatgtccaca 2041 ttaagcagcg tcacgcggac gagtggctgc gcgccaagat ggcacgctcg cacaatccgc 2101 agttcaaacc ggccgacgtt taaacctgac ccctcacaat tgtgtttaat cattatacgt 2161 ataattaaac tgt