Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster uncharacterized protein, transcript variant


LOCUS       NM_132404               2173 bp    mRNA    linear   INV 26-DEC-2023
            A (CG2889), mRNA.
ACCESSION   NM_132404
VERSION     NM_132404.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 2173)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2173)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2173)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 2173)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 2173)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 2173)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 2173)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 2173)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 2173)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 2173)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 2173)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 2173)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 2173)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 2173)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 2173)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 2173)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 2173)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 2173)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On May 8, 2012 this sequence version replaced NM_132404.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2173
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..2173
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /map="9D1-9D1"
                     /db_xref="FLYBASE:FBgn0030206"
                     /db_xref="GeneID:31977"
     CDS             378..2123
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="CG2889 gene product from transcript CG2889-RA;
                     CG2889-PA"
                     /codon_start=1
                     /product="uncharacterized protein, isoform A"
                     /protein_id="NP_572632.1"
                     /db_xref="FLYBASE:FBpp0071385"
                     /db_xref="GeneID:31977"
                     /db_xref="FLYBASE:FBgn0030206"
                     /translation="MICRLCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILP
                     DDGISTSVCTECCEHLEDFNGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVN
                     IDELPLAAGDMDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQ
                     ASDSEPEVTEGQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELADL
                     LDDGGKRRRRKAPDQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSASC
                     DLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTIC
                     KKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTDQLE
                     HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAP
                     AVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLTTNL
                     QCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLRA
                     KMARSHNPQFKPADV"
     misc_feature    381..614
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zinc-finger associated domain (zf-AD); Region:
                     zf-AD; smart00868"
                     /db_xref="CDD:214871"
     misc_feature    <1017..>1247
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="BNR repeat-like domain; Region: BNR_2; pfam13088"
                     /db_xref="CDD:463781"
     misc_feature    1203..1268
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1203..1205,1212..1214,1251..1253,1266..1268)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1278..>1436
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="N-terminal domain of Oryza sativa transcription
                     factor SUPPRESSOR OF FRI 4 (OsSUF4), Arabidopsis thaliana
                     SUF4 (AtSUF4), and similar proteins; Region: SUF4-like;
                     cd20908"
                     /db_xref="CDD:411020"
     misc_feature    1278..1346
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:411020"
     misc_feature    1293..1346
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1299..1301,1305..1307,1311..1313,1317..1322,
                     1329..1334,1341..1343,1383..1385,1389..1391,1401..1406,
                     1413..1418,1428..1430,1488..1490,1494..1496,1500..1502,
                     1506..1511,1518..1523,1530..1532)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1299..1301,1317..1319,1338..1340,1341..1343,
                     1365..1367,1386..1388)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:411020"
     misc_feature    1368..1433
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:411020"
     misc_feature    1368..1433
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1473..1535
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1560..1625
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1560..1562,1569..1571,1608..1610,1623..1625)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1647..1709
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1647..1649,1656..1658,1695..1697,1707..1709)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1818..1883
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1818..1820,1827..1829,1866..1868,1881..1883)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1833..1835,1839..1841,1845..1847,1851..1856,
                     1863..1868,1878..1880,1920..1922,1926..1928,1938..1943,
                     1950..1955,1962..1964,2004..2006,2010..2012,2016..2018,
                     2022..2027,2034..2039)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1905..1967
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1989..2045
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
        1 ctacaaacaa aatcacagat ttacaaaccc gctgtgcaat taaacataat ttagcaaaca
       61 aatctcggtt ccggcctact tccagagcga gagcatgaga gaccatagag cttacccttt
      121 cgcacgcaga gcacacaccg caaacacacg tattttgcag acaattaaaa acgtagacca
      181 taaattgtaa gagaaattaa agagaaatac tcaacgatca gggtggccac cccgcaaaaa
      241 actcctgaga tgaagttttg ccattcacaa ttggattctg ttatcgattc acgataggtg
      301 aattatgttg tttacaacga aaaactgttt aaatttttta tttatttgac tttgcgttgt
      361 ggttctgttc gcgcgaaatg atttgtcgcc tttgcctgcg atgtcttagt cccggaagcg
      421 ctgtcttcct ctttgagacg gacgatacgc ttgcggagac gcgcctggtc aagatgattg
      481 cgaagtttct gcagctggag atcctaccag acgacggcat ctcgaccagc gtctgtaccg
      541 agtgctgtga gcatctggag gacttcaatg gcttctggca gctggtggag cagaagcagt
      601 gctcactcaa gaaggagttc cttaccgtgg acgtcgactg tgcggccatg aagtggacgg
      661 gcggtgtgga cgtggacgtc aacatcgacg aactgccgct ggcggctggc gacatggacg
      721 agaaaccgtt ggacctgcac aaccttagtc tgctgggaag cgtgctggac gtgaatgtgg
      781 acagtgtgga agtcagggaa ccgatcaagg agcagctgcc ctgcgaggag gaggaggacg
      841 agaagccctg cctgcaagct agtgatagcg aaccggaggt gaccgagggg cagccggaat
      901 ctgaatctga ctcctcagat gatgaacccc tggtccgtct gaaatcgaaa atgaagccca
      961 agcgcaaaac ctcggcacgt tcctccaagg atcagggtcc gatatcgctg cagcaggagc
     1021 ttgcagatct gctcgacgat ggtggcaagc gtcggcgcag gaaggcacct gaccagcgaa
     1081 caaccaccga gtcgcaggag tccgagctac aggccgttct cgagcgcaag cccaagggct
     1141 gctcccgtgc tcagctggcc aagagctacg agaaggccat tgctagctac atgagtgcaa
     1201 gctgcgacct gtgcgaattt agtgctccct acctatccga attgaagacc cacttcctgg
     1261 aggtgcacca gcgcgagtac tacatcaagt gctgcggcaa agtctttaca cgcgcttcca
     1321 agctgatgga ccacatccgc aaacatatca accccaagct atttacctgc accatttgca
     1381 agaagtcgct caactcgcag gactacttgg ccactcatat cgagacggtg cacaacaagg
     1441 tggctcaaat cggcaaggtg ctcaagttcc cgtgccccaa gtgcgaacgc accttcagca
     1501 gcgagcgccg tatggccaat catctggcca agcacgacac cgatcaactg gagcacacct
     1561 gcgagatctg ctgcaaaagc tttgccaatg tacaccgcct gcgaaggcac atccaatcca
     1621 tccacgaaga cctgcatcgt cacgtttgcg acatttgcgg gaagaagttc aagttcaagc
     1681 cctccttcga gcgccatttg ctggagcacc agggcgtcgt ggccccggct gtggagtgcc
     1741 ccatctgccg tgtttggctg aagaacgagc acagcttgcg cctgcaccgc ttcacacacg
     1801 acagcacgga caccgtgtgt ccgcattgtg gcaagacctg cacatcgcgc acagcgctcc
     1861 gcggtcacgt caaatatgcc cacaagctga ccaccaatct gcagtgcacg ttctgcgaga
     1921 aaaccttcaa gcagcagcgc aacctggacg agcacatggc catccacacg ggcctgcagc
     1981 tgtacaactg tccgcattgc cccaaggagt gccgttcccg ctccaatatg tatgtccaca
     2041 ttaagcagcg tcacgcggac gagtggctgc gcgccaagat ggcacgctcg cacaatccgc
     2101 agttcaaacc ggccgacgtt taaacctgac ccctcacaat tgtgtttaat cattatacgt
     2161 ataattaaac tgt