Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster megalin, transcript variant E (mgl), mRNA.


LOCUS       NM_132335              15229 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_132335
VERSION     NM_132335.3
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 15229)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 15229)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 15229)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 15229)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 15229)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 15229)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 15229)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 15229)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 15229)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 15229)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 15229)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 15229)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 15229)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 15229)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 15229)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 15229)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 15229)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 15229)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_132335.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..15229
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..15229
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Megalin"
                     /map="8D9-8E4"
                     /db_xref="FLYBASE:FBgn0261260"
                     /db_xref="GeneID:8674055"
     CDS             456..14765
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="CG42611 gene product from transcript CG42611-RE;
                     CG42611-PE; mgl-PE; LDL receptor-related protein 2"
                     /codon_start=1
                     /product="megalin, isoform E"
                     /protein_id="NP_572563.3"
                     /db_xref="FLYBASE:FBpp0310028"
                     /db_xref="GeneID:8674055"
                     /db_xref="FLYBASE:FBgn0261260"
                     /translation="MNPTPVGIGFGFGRKPPSKARMRSRWRPPSATTLLTHDPANGDS
                     HTAADPLQVTDAAPSGPPSSSSSSPIGDRHSQHHSSSAIDRRLQQQQHHQSPQHHRQR
                     GQLTTLALLLLALVAISNLETLLAVRTEGPRNRHGSPGGSLASTGGSSSGINTECPTD
                     SFRCNNGKCISHHWVCNYQKDCDDGEDEMQSCPPPECETPQLNCGQYTFNKTYCIPPH
                     YRCDMIEDCEDKSDEAQCTYRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYL
                     DCRTGRDEVGCSGVACRLDQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHH
                     AQFRCTNALCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILK
                     SQLCDGKRDCEDGSDEETNCSIASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTC
                     VDLDECAEWGHCDQLCTNTLGSYTCQCAQGYTLINDSKCIAPDANNLQLIFAHDRAIM
                     RMLPHGSEPKILANATAAAGVTFHYARNTLYWSDIKTRKVQSLPLDAQNKAVSPFDQT
                     LPGTWAPVALAVDWVGDKIYVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPT
                     AGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESV
                     DYEGAHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAK
                     DIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQL
                     ETDLKLCKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVVSRRARFVGLDFDARDE
                     FIYYSDVLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVL
                     STRNVTHRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANTDGSGLLVFKNVT
                     LGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMY
                     ITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQPCHRNNGGC
                     QKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGERLADDQVSCIPDPSAEPPVQ
                     PCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGRCIPQ
                     NFRCDQENDCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDF
                     CAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQ
                     CVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDC
                     SDHSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKC
                     PHGQWQCPGVSERCVNITSVCDDTPDCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPN
                     GALCVCPPGSEIGEDGYTCIDSNECDPPGLCSQQCTNTKGSYFCSCTDGYVLEPNKHT
                     CKAVNHTAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKL
                     KKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVL
                     VRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLT
                     LDIATKRVYFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQL
                     NRVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMTPNPCAGSRCQHLCLLSPSAP
                     EGYSCKCRPGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIES
                     STGLDFDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGIENGIVGAPYTIAFD
                     WLGRNLYIGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIALDPTEGKLFW
                     IDEGVLEVPIKIGRVDMNGQNPIVVFQEFAHPESLAVDTEKKMVYYSASNPAVIGVMD
                     YNGDDHTLILMKDSHPMAKPRSLGILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNE
                     SDLRSMMIYKKRALMQHPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEINCVAYK
                     IFAVVSQLDMIRGYSLSDSSEAMVPISGPGHHILHVDVMYREQWIYWAEYNRGYWNGI
                     FRSRPNGTDLQHVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRK
                     VLVKTTTDAPRELAVNPIKRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLT
                     IDMQTHDIYWVDSKLDTIQKISYNGANRKIIRRDLPNPMGIAVYLNDVYWVDRNLMTV
                     FKASKHSANETATSVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPP
                     DGGASGTSGGRNFRCECATGKLSADERKCEVVNEYLVFATRTEIRAVNLDPHSTEVPF
                     TPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGHDDITVVLNKGINPEGI
                     AYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLDPCNGTLFFTDWGRF
                     GTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIERSDLDGQN
                     RELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKRLEDSPRDIRI
                     YSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEA
                     SKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKC
                     DHENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDETHERC
                     PMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNH
                     RCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDC
                     LDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTT
                     LHNCATQQPCGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFT
                     CQNFKCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYP
                     DCADESDEPAHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDE
                     CLEQPGACSQHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNM
                     SVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAV
                     IRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVVDPRAIVVHPG
                     IGYLYFTSWHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLD
                     YIAYADLEGRHRHTVLSGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVL
                     RNTTHRPYDLHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAP
                     IFKCACPNQFYLARDMKTCVANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPA
                     TCAPRHCRAGTFQCKNTNCTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRC
                     ILDSWRCDGDADCKDGSDEDPAVCFKRTCDPKTEFSCKNGRCIPQLWMCDFDNDCGDD
                     SDEPAYMCRQRNCTTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCNPE
                     TDFKCGNNRCIPKQWMCDFADDCGDASDENEAVCKGRYRECSESEFRCGNGKCISSRW
                     QCDHEDDCGDNSDEMHCEGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPP
                     RFPGGRYCPESRFQCNNNLCVSLSDLCDGTDDCGDGSDEDPSVCSDFNCDTLRRFQCS
                     NERCVARYQICDGVDNCGDGSDENNMTLCASKQKPCDLYTQYQCANKHCIERSQVCDF
                     SDDCGDASDELGCHHTSSCSEANRGGCQQHCHNLTDGGYICTCYPGYIIAADNKKKCS
                     DVDECLTRQHTCSHQCHNLNGTYSCSCREGFHLTDGASGVCRAEKEDVILLFVNGQEI
                     RGLNWHKSEEFAVIAAEKRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIG
                     FAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRYRRSIVNAG
                     LEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEMIRHPAGLTIDYSQD
                     HIIYWVDTKLNAIESMRADGSRRKAIVRGDQLRHPVSLDLFESNMFWMTRDTGELVRQ
                     DKFGRGVQVVLHRYIVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLLVPGGHRCACP
                     DASGPPPSHRSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELLCECRTQFVGE
                     HCETSTMGAFGHGDANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARMPAMTSS
                     QSVTFRHGSNVEFNESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYDAVQS
                     GTTADPGMGNGSGIYDVPGEPSAKVKSMGHHAGGSFTEPASAIIAPSSITHKASPQLQ
                     LRTRELDPSADTGKDTQFLVEEDKSEC"
     misc_feature    924..1022
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(939..941,963..965,996..1001)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(975..977,984..986,996..998,1014..1019)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1005..1019
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1065..1163
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1080..1082,1098..1100,1131..1136)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1110..1112,1119..1121,1131..1133,1149..1154)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1140..1154
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1329..1436
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1344..1346,1371..1373,1404..1409)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1383..1385,1392..1394,1404..1406,1422..1427)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1413..1427
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1449..1553
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1464..1466,1488..1490,1521..1526)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1500..1502,1509..1511,1521..1523,1539..1544)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1530..1544
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1566..1691
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1581..1583,1623..1625,1656..1661)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1635..1637,1644..1646,1656..1658,1674..1679)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1665..1679
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <1794..1919
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:469594"
     misc_feature    <1929..2357
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="DNA-binding beta-propeller fold protein YncE
                     [General function prediction only]; Region: YncE; COG3391"
                     /db_xref="CDD:442618"
     misc_feature    2172..>2603
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    2172..2285
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2301..2417
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2424..2534
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2742..2870
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    3015..>3431
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Sugar lactone lactonase YvrE [Carbohydrate
                     transport and metabolism]; Region: YvrE; COG3386"
                     /db_xref="CDD:442613"
     misc_feature    3219..3347
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    3372..3476
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    4017..4124
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(4035..4037,4059..4061,4092..4097)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4071..4073,4080..4082,4092..4094,4110..4115)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4101..4115
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4134..4232
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4152..4154,4176..4178,4209..4214)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4188..4190,4197..4199,4209..4211,4227..4232)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4218..4232
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4257..4364
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4272..4274,4299..4301,4332..4337)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4311..4313,4320..4322,4332..4334,4350..4355)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4341..4355
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4377..4484
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4392..4394,4419..4421,4452..4457)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4431..4433,4440..4442,4452..4454,4470..4475)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4461..4475
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4521..4616
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4524..4526,4551..4553,4584..4589)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4563..4565,4572..4574,4584..4586,4602..4607)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4593..4607
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4626..4724
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4644..4646,4668..4670,4701..4706)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4680..4682,4689..4691,4701..4703,4719..4724)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4710..4724
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4758..4862
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4776..4778,4806..4808,4839..4844)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4818..4820,4827..4829,4839..4841,4857..4862)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4848..4862
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5019..5114
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    5328..5450
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5454..5588
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5523..5642
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    5589..5717
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6411..6566
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6906..>6992
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    7230..7370
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7431..7553
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    7509..7631
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8190..>8588
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    8232..8321
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8355..8489
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8466..8594
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    9054..9158
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9069..9071,9093..9095,9126..9131)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9105..9107,9114..9116,9126..9128,9144..9149)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9135..9149
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9171..9278
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9186..9188,9210..9212,9243..9248)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9222..9224,9231..9233,9243..9245,9267..9272)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    order(9252..9257,9264..9272)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9303..9404
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9318..9320,9345..9347,9378..9383)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9357..9359,9366..9368,9378..9380,9396..9401)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9387..9401
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9555..9653
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9573..9575,9597..9599,9630..9635)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9609..9611,9618..9620,9630..9632,9648..9653)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9639..9653
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9693..9800
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9702..9704,9744..9746,9777..9782)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9756..9758,9765..9767,9777..9779,9795..9800)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9786..9800
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9837..9932
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9852..9854,9876..9878,9909..9914)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9888..9890,9897..9899,9909..9911,9927..9932)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9918..9932
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9963..10067
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9978..9980,10002..10004,10035..10040)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10014..10016,10023..10025,10035..10037,10053..10058)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10044..10058
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10083..10181
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10101..10103,10125..10127,10158..10163)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10137..10139,10146..10148,10158..10160,10176..10181)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10167..10181
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10230..10316
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10332..10442
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10539..10637
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10671..10799
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10857..10988
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    10947..11063
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11061..11189
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11274..11432
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11442..11543
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11457..11459,11487..11489,11520..11525)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11499..11501,11508..11510,11520..11522,11538..11543)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11529..11543
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11568..11672
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11583..11585,11607..11609,11640..11645)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11619..11621,11628..11630,11640..11642,11658..11663)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11649..11663
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11682..11780
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11697..11699,11724..11726,11757..11762)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11736..11738,11745..11747,11757..11759,11775..11780)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11766..11780
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11805..11906
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11826..11828,11850..11852,11883..11888)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11862..11864,11871..11873,11883..11885,11901..11906)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11892..11906
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11934..12038
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11949..11951,11982..11984,12015..12020)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11994..11996,12003..12005,12015..12017,12033..12038)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12024..12038
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12066..12158
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12078..12080,12102..12104,12135..12140)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12114..12116,12123..12125,12135..12137,12153..12158)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12144..12158
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12192..12296
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12207..12209,12231..12233,12264..12269)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12243..12245,12252..12254,12264..12266,12282..12287)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12273..12287
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12309..12413
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12324..12326,12348..12350,12381..12386)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12360..12362,12369..12371,12381..12383,12399..12404)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12390..12404
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12441..12536
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12456..12458,12480..12482,12513..12518)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12492..12494,12501..12503,12513..12515,12531..12536)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12522..12536
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12582..12668
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12582..12584,12606..12608,12639..12644)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12618..12620,12627..12629,12639..12641,12657..12662)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12648..12662
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12711..12806
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12717..12719,12741..12743,12774..12779)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12753..12755,12762..12764,12774..12776,12792..12797)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12783..12797
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12942..13037
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(12942..12944,12951..12953,12993..12995)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    13281..>13733
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    13326..13463
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    13503..13628
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    13575..13706
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    13581..13721
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
ORIGIN      
        1 tcagttggtt tccaaaggcg cgccgtcgca gttcgaaaac cgcggctctc gccagcaaaa
       61 taaaaaaaaa aacaacagca atttaattta aataattaca aaagagtcta tttaagaaaa
      121 aaccttctcg aagaaaggca agaagaaaaa tggcgcgcgt tcaacaaaga gaaaattaga
      181 aacgaaaacg attttttttt caagtgctga caaacccacc aaaagaaaaa aataaatatt
      241 ccaaaaagta aaacgcaaca aagccagagg agcgggcaac cctaaaaaag acagaagtgc
      301 ggtgggcaga gaagaggtca ccagagggtc accaaaaaaa acaaaaaaaa accgaaacga
      361 acaagaccca aatccgaatc gaggattccc acagaaacca aacaggaaaa ggagaaagga
      421 gcggagcagc aagcgaagcg cccgacgaac caaaaatgaa tccgacgccc gtgggcattg
      481 gattcggatt tggtcgcaag ccgcccagca aggccagaat gcgttctcgc tggcgaccac
      541 catcagcgac aaccctgctg acccatgacc ccgccaacgg cgacagccat acggccgccg
      601 atccgctgca ggtcactgat gccgccccat cgggcccacc atcatcttca tcatcctcgc
      661 ccatcggcga ccgccattca cagcatcaca gcagcagcgc catcgatcgg aggctgcagc
      721 agcagcagca ccaccaatca ccgcagcacc atcgtcagcg cggccagttg acaaccctgg
      781 cgctgctgct actggccctt gtggccatca gcaacctgga aaccctgctc gccgtgcgca
      841 ccgaaggacc gcgcaaccgt catggatcac caggtggcag cctggccagc acaggtggca
      901 gcagcagtgg catcaacacg gagtgtccaa cggactcgtt tcgatgcaac aatggcaagt
      961 gcatctcgca ccactgggtc tgcaattatc aaaaggactg cgacgatggc gaggatgaga
     1021 tgcagtcgtg ccctccaccg gaatgcgaaa cgccgcagtt gaattgcggg cagtacacgt
     1081 tcaacaagac ctactgcatc cctccgcact atcgctgcga tatgatcgag gattgtgagg
     1141 acaaatcgga tgaggcgcag tgcacgtacc gcaagtgcca gcacacggac ttgttttgca
     1201 acacgcccac tggagcaccg gcggagggcg cccgcctcac cggaccctgt gtgcccaagg
     1261 agaagcgctg cgacggctac ttggactgcc gcaccgggcg ggatgaggtc ggctgcagtg
     1321 gcgtagcctg tcgcctcgac cagttccgct gtgccaacgg actcaagtgc atcgacgccg
     1381 ccctgaagtg caatcaccgc gatgattgtg gcgacaactc tgacgagcag ggatgcaact
     1441 tcccgccatg ccaccacgcc cagttccgtt gcacgaacgc actgtgcata ccgtacaact
     1501 ttcattgcga tggctaccac gactgcgccg acaagagcga cgaggccaac tgcacggcca
     1561 tcgcctgtcc ggacaacaag cacctctgtc cacgtggcgg cgccagcggc acgcccaagt
     1621 gcatcctgaa gtcgcaactc tgcgacggca agcgggactg cgaggatgga agcgatgagg
     1681 agaccaactg ctctattgcc tcatgccccg ccctgagctg tgagttcaaa tgcggaccct
     1741 cgctgacggg tggagtgtgc tactgtaagc cgggccaatc gctggctcct gacaaccgga
     1801 cctgtgtcga cctggacgag tgcgcggaat ggggtcactg cgaccagctg tgcaccaaca
     1861 cactgggatc gtatacatgc caatgcgccc agggctacac gctcatcaac gactccaagt
     1921 gcatagctcc ggatgcgaat aacttgcaac tgatattcgc ccacgatcgt gccatcatgc
     1981 gaatgctgcc gcatggcagt gagcccaaga ttttggccaa tgcaactgcc gcggcgggtg
     2041 tgaccttcca ttatgcccgg aacacactgt actggtcgga catcaagacg aggaaggttc
     2101 aatcactgcc gctggatgcg cagaacaagg ccgtctcgcc cttcgatcag acccttcccg
     2161 gcacctgggc gcccgtcgct ctggccgtcg actgggtggg cgataagata tatgtggcgg
     2221 atttggtggg tcagaagatc gatgtcttcg agctgagtgg tcaatggcat gcggttgttc
     2281 tgggctctaa tctcacctca cccgccgatc tggcactgga tcccacggct ggtctaatgt
     2341 tcgttgcgga tggcggtcag gtgctccgtg cccatatgga tggcacacat gccagatcga
     2401 ttgtctcgga ggcggcctac aaggccagcg gtgtgacggt ggacattatc agcaagcgtg
     2461 tcttctggtg cgactccctg ctggactaca ttgaatccgt ggactatgag ggtgctcatc
     2521 gggtgatggt gctcaggggt caacaggttc cgagtccctc gcgattggct ctgttcgaga
     2581 atcgtatcta ctggacggat gccaccaagc agggcatcat gtcggtggac aagttcgagg
     2641 gtcccacctc cattcaggtt acgtacaagg ccaaggacat cagggagccg aagggcatca
     2701 ttgctgttca tgcgctcagc cagcccagag tatcgaatcc ctgtggcaac aacaacggtg
     2761 gctgcaatca catgtgcatt gtgaccgccg taaagggagc acccactggc ctgggattcc
     2821 gttgtgcctg ctccacgggc taccagctgg aaacggatct gaaactatgc aagccagtca
     2881 gtgaattcct catgtactcg cagcagagat tcatcaaggg aaaggtattg gaaccggtaa
     2941 ttgaaggatt tagtgatgcc atcatgccgg tggtttcgag gcgtgctcgt ttcgtcggtc
     3001 tggatttcga tgcacgcgat gagttcatct actactcgga tgtgctgcag gatgtgatct
     3061 acagggtgca ccgaaacgga actggccggg agatcgtctt ggcctctcag aatgaaggcg
     3121 ttgagggact ggccgtcgat tgggcctcca agaatctgta ctacatcgat tcgcgcaagg
     3181 gcaccttgaa cgtcctatcc acccgaaatg tgacacacag aagaacccta ctgaaaaacc
     3241 tgaaacgtcc cagggccatt gtggtccatc ccaatcgtgg tttcatcttc ttctccgaat
     3301 gggaccgtcc tgcgaatatc accagagcaa acacagatgg tagtggtttg ttggtgttca
     3361 aaaatgtaac cctcggctgg ccaaatggac tatccatcga cttcaaggag gatcgtgtct
     3421 actggtgcga tgctctattg gatcacgttc agcatgccaa cctggatggc acggatatta
     3481 agacggtgaa ctcacgactg gtgcgacatc cgttctccat tgtcattcac aacgattgga
     3541 tgtatatcac ggactggcgc ctggatgcca ttatacgttt gcacaagctt acgggcgagc
     3601 aggaggagat gatggtcaga gagccgcaga ccaatagact gtacggcgtt aaggtgtaca
     3661 gtcatgaggt ccagaggatc gcggacacgc aaccttgtca caggaacaat ggtggctgcc
     3721 agaagatctg tttcgctgtt cccatcggag catcaaatgg taccgatggg gtgaccactt
     3781 cgtcgccctc gttcggtcgc ctacagtcgc gctgctcgtg tccctatggc gaacgattgg
     3841 ccgacgacca ggtgagctgc attcccgatc ccagtgccga gccaccagtg caaccctgcc
     3901 cgaactcatg ggactttacg tgcaacaatc agaggtgtat tcccaagtcg tggctatgcg
     3961 acggtgatga tgactgtctg gataacagtg atgaggagca gaactgcaca aagcccactt
     4021 gcggatccaa cgagttccag tgtcgatcgg gtcgctgtat tccgcagaac ttccgttgtg
     4081 accaggagaa cgattgcggt gacaactccg atgagcagga gtgcggcaat gtgacctgtg
     4141 gaacgtccca gtttgcctgt gccaatggac gctgtattcc caatatgtgg aaatgcgata
     4201 gcgagaacga ttgtggggat agcagtgatg agggtgactt ctgtgccgaa aagacctgcg
     4261 cctatttcca gttcacgtgc ccgcgaacgg gtcactgtat tccacagagt tgggtttgtg
     4321 acggcgacga tgattgcttt gacaaacagg acgagaagga ttgtccaccg atatcctgtc
     4381 tggcgaatca attcaaatgc gcggatctaa ggcaatgtgt agaggagtcc tacaaatgtg
     4441 atggcatacc ggactgtaat gatggctccg atgaggtggg ctgtccttcc atgggaccaa
     4501 atcagtgtaa cctggagaag cacttccgtt gcaagtccac tggcttctgt attcccatcg
     4561 cctggcactg tgatggctcc aatgattgtt cagatcattc ggatgagcag gattgtggtc
     4621 agatcacctg tgcccagaac ttcttcaagt gcaacaacac gaactgtgta tttaaggcat
     4681 acatatgcga tggcaaggac gattgcggtg ataattcgga tgagggagct gaacacgcat
     4741 gtgtcccacc cccgttcaag tgtccccatg gtcagtggca gtgtcctggc gtttccgaga
     4801 gatgcgtgaa catcacatct gtctgtgatg atacgcccga ttgtcccaat ggttcggatg
     4861 agggtgaggg ctgcgatttg gccgagtgcg aacatcaggc gggtcagtgc tctagcttct
     4921 gtcagaagac ccccaacggt gcgttgtgtg tgtgtccacc tggttcggag atcggcgaag
     4981 atggctacac ctgcatagat agcaacgagt gcgatccacc gggtctctgc tctcagcaat
     5041 gtaccaacac caagggctcc tacttctgct cctgcacaga tggctatgtt ctcgagccga
     5101 ataagcacac ttgcaaggca gtaaaccaca ccgccgcctt cctaatcatc tcaaatcgtc
     5161 actccattct tgtggcagat ctcaaggaac agggactcga gagggtgccc atcatagtgg
     5221 aaaatgtggt ggccactgct tccaatatgc acacaggcac tattttctgg agcgacatga
     5281 aactaaagaa gatctcccga ttagatcgcg gtatggagcc acaggaaatc attaacacgg
     5341 gcctagactt ggtcgagggc ctggcctatg attggattgc ccagaatctc tactggctgg
     5401 acagcaaact gaacaccatc gaagtgtccg cggagaacgg ttccaatcgt ctggttttgg
     5461 tcagggaaaa catcacccaa ccaagaggca tgtgcatcga tcccagtccc ggagcaagat
     5521 ggatcttctg gactgactgg ggagagaacc caagagtgga gagaattggc atggatggta
     5581 ctatgagaaa aacgatcatc aataccaaga tctactggcc caatggctta actttggata
     5641 tagcaacaaa gagggtttac tttgccgact ccaagctgga ctttattgat ttctgctact
     5701 acaacggcac cggtagacag caagtcctgg ccagtagtca ctatctgctg catcctcact
     5761 cgttgtcctt gttcgaggat acgctctact ggaccgacag gcaattgaat cgagtgttgt
     5821 ccgccaataa gttccgtggc aagaatcaga ccgtcgtttc ccacctgata agtcaaccct
     5881 tgtccatcca cgttcatcac gcttccctgc agcccatgac tccgaatccc tgcgccggat
     5941 cacgctgcca gcacttgtgt ctgctgagtc ccagtgcccc ggagggttac tcctgtaagt
     6001 gcaggccggg ctttaagctc ctgagcgaag gtcgttgcat cgaggaggag aatcccttcc
     6061 tcatggtcgt caagggtaca caaattgtgg atcttccttt gaatggtggc gatgcgagag
     6121 ccggagctct ggccccagtt attggaatcg aaagcagcac gggcttggac tttgatcgca
     6181 aaggagagac gctctactgg gtgcagggca gggaggatga tgatgagaac tgcaccatct
     6241 atacgacacc ctatggtggt ggcaataaga cactcttcct gggtatcgaa aatggaattg
     6301 tgggtgcacc ctacaccatt gcattcgatt ggctgggcag aaatctttac attggcaacc
     6361 gggtggccag caacattgaa gccgtgcgcg tggatggcaa gcaaaagtat cgcaccataa
     6421 tcctggccaa cgatggttat cccaactccg tgtcgcggcc caaacaaatt gcactagatc
     6481 ccaccgaagg taagctcttc tggatcgacg aaggagttct ggaagtgccc attaaaattg
     6541 gcagagttga tatgaatgga cagaatccca ttgtagtctt ccaggagttt gcccatcccg
     6601 aatcgttggc cgtggacacg gagaagaaaa tggtgtacta cagtgctagc aatccagcgg
     6661 tgatcggtgt catggactac aatggtgacg atcatacact gatcttgatg aaggactcgc
     6721 atccgatggc caagcccagg agcttgggca tcctagacca taggctttac tacctggatc
     6781 cgttgtacga gcgtattgtg aggattgatc tgccgcacgg tgataatccc aagaccattg
     6841 tcgacaacga gtccgatctg cggtcgatga tgatctacaa gaagcgcgcc ctgatgcaac
     6901 atccctgcca gacgaacaac ggtggctgca agcacctttg cattcccgga cctggtgcaa
     6961 ccagaacgtg tgcctgcggc attggataca gaaaggaaaa cgagatcaac tgcgtggcgt
     7021 ataagatctt tgccgtggtc tcccaactgg acatgatcag gggctatagc ttgagcgata
     7081 gctccgaggc gatggtaccg ataagcggac ctggccacca cattctccat gtggatgtga
     7141 tgtatcgcga gcaatggatc tactgggcgg agtacaatcg tggctactgg aatggcattt
     7201 tcagatcgcg acccaatggc accgatctgc agcatgtggt caaggatggc atcggcagta
     7261 atggcatcag gggtttgacc atcgattggg tggccggcaa tatgtacttc accaacgtct
     7321 atccccatga gaattatgtg gaagtttgct ggctggatgg tagcaatagg aaagtgttgg
     7381 tgaagacaac cacagatgca ccacgtgaac tggccgtgaa tcccattaag aggctactct
     7441 attggatcga ctatggccag catcctagga ttggaaaagc cctcttggat ggcagcaaat
     7501 ggacaccact ggtgacatcg ggcatttcgt tgcctcgcga tctaaccatt gacatgcaga
     7561 cccatgacat ctactgggtg gactcgaaac tggacaccat tcagaagatt tcgtataatg
     7621 gcgccaatcg caagataatc cgcagagatc tgcccaaccc catgggcatt gctgtctatc
     7681 tgaacgatgt ctactgggtg gataggaatc tgatgaccgt gttcaaggcc tccaagcata
     7741 gtgccaatga aactgccacc agcgtgagaa cgaatctgga aaagcttagg gacatcgcca
     7801 tatacaacat caacaatcag ccgcaggacg atacaaatcc atgtgcgcat ttaggaaacg
     7861 gtggctgtga tcagttgtgt ttcagtttcc caccggatgg cggagcctcc ggtacctcag
     7921 gaggaaggaa tttccgttgc gaatgtgcca ctggaaaact gagcgccgat gaaagaaagt
     7981 gtgaggtggt caacgagtac ctagtcttcg ccacaagaac tgaaattcga gctgtcaatc
     8041 ttgatcccca ttccacggaa gttcccttca ctccactgac aaatctcaca aatgtcgtgg
     8101 gtctggactt tgattttgcc cacaaccgaa tgctgtatac ccaaatccgt ccgtgggcca
     8161 agattgcgta caccaaggcg aataagccgg ggcacgatga catcactgtg gtcctgaaca
     8221 agggcattaa tcccgagggc attgcctacg attggaccca gcagaaaatc tactggactg
     8281 atagctcgaa caactcgatc tatgccatga atttggatgg tagcgaactg gttatgattg
     8341 cccgcgttga aagaccgcga gctattgtcc tcgatccctg caatggcacg ctattcttta
     8401 cggattgggg caggttcggt acgtctggca agattttccg caccaccatg gcgggttccc
     8461 tgaagagagc cattgtcgac aaggatcttt cgcagccaag tggcttggct atcgattatg
     8521 atgagagacg cctatactgg acggatgcgg tgagagagaa gatcgagaga tccgatctgg
     8581 acggtcagaa tcgagagctt ctggtggcag ccaccattta tccgttcgcc ataaccgtgt
     8641 tcaggaacta catctactgg acggatcttc agctgagagg tgtctatagg gctgagaagc
     8701 acactggagc caacatggtg gagatggtga agcgattgga ggattctccg cgagatattc
     8761 gcatctacag ttccgatcgc caaaagtgca atgtgaatcc gtgcaggatc aacaacggcg
     8821 gatgtgccca gagctgtcat cctgccccga atggcaaggc cgagtgcaag tgcgacgata
     8881 gcaccaaggt ggtgaacgag ggaaggatgt gtgccccgcg aaacaatact tgcgaggcca
     8941 gcaaattcta ctgcaagaac ggcagatgca tttcgagaat gtggtcctgc gatggcgacg
     9001 acgactgtgg cgacaactcc gacgaggatc ccaactattg tgcctatcac tcctgctccc
     9061 ccaacgagtt ccgctgcaac aacggacgct gcatctttaa gtcgtggaag tgtgatcacg
     9121 agaacgactg caaggatggt tccgatgagc tgggctgcgt ctatccacca tgtgtggatg
     9181 gtgagttcac ttgcgccaat ggacggtgta ttccacaggc tcaggtgtgc aatggtgtga
     9241 atgactgcaa ggataatgcc acatcggatg aaacgcacga acggtgtccc atgaacacca
     9301 cttgtccggc gaatcatctg aagtgcgaga agaccaacat ctgcgtggaa ccctattggt
     9361 tgtgcgatgg cgacaacgat tgtggtgaca actccgacga ggatccactg cattgtggcc
     9421 aacgaacttg tccaaccaac agtttccggt gtcccaacca ccgatgcatt ccagctacct
     9481 ggtactgtga tggtgacgat gactgtggcg atggagccga tgaaccacca gattactgca
     9541 aatcggaagg acgcacatgc ttcggggatc tgttcacctg cgacaatggc aactgcatac
     9601 caaggatcta catctgcgat ggcgacaacg attgtttgga caacagtgac gaggataacc
     9661 ggcaccagtg caatgaccgt aagtgtgatg aggaaacgga gttcacttgt gtggagaaca
     9721 aatcctggca gcgtgcccag tgcataccca aaaaatggat ctgcgatggt gatccggatt
     9781 gcgttgacgg agccgatgag aatactactc tgcacaattg tgccacccag cagccctgtg
     9841 gcgaggatat gttcacctgt ggcaatggac gttgcatcaa taagggatgg atctgtgacc
     9901 atgacaacga ttgcggcgat ggtaccgatg aaggcaaatt ctgtaactcc aagtacaaga
     9961 cctgttcggc ccaggagttc acctgccaga acttcaagtg catccgaaat caatcccggt
    10021 gcgatggcga agacgactgc ggtgatcact cggatgaggt gggctgtgcc aaggagaaca
    10081 taacctgtcc acagggtcag ttcgcctgta cgaatggtca gtgcatcgac tacaatctgg
    10141 tgtgcaacaa gtatccggat tgtgccgacg agtccgacga acctgcccat tgcaacgtgg
    10201 atgagtgcgc caaggtggag atcaatcagt gtggccacaa gtgcgtggac acgctgacag
    10261 gttactactg cgactgcaat gagggctaca aactgctagc cgatggcaaa gcctgtgcgg
    10321 atgtggatga gtgcctagag cagccgggcg cttgttctca gcactgttcc aataccccgg
    10381 gtggattcta ctgcaagtgc gacgagacct actacgaaag gcagaacgat gagcacacgt
    10441 gcaagcgtaa ggacaagatc ccaccgtggc tgatcttcac caacaagtac tatgtgcgca
    10501 atatgtcggt ggatggacat cagtacaatc ttatgcacca ggatctgatg aatgtggtgg
    10561 ctctcgactt cgatatacgc gaggaataca tgtacttctg tgatgtcacg gccaagacca
    10621 tcttcagagc gaagtatgga gaggccgatg acgagatgcc gccggagagg gaggctgtca
    10681 tcaggcacga ttcccatggc ctggagggca tcgccatcga ttgggtgggt cgcaaactgt
    10741 actggctgga caggcactcc aagaacctgg atgtctccga attggacggc agcaagcgca
    10801 agacactgag aagtggcgtc gtcgatccgc gtgccatcgt cgtgcatcct ggtatcggtt
    10861 acctgtactt cacctcctgg catctgcaag cctatattgc caaaatgggc atggatggtt
    10921 cgaacttctc gagaattcta aactggaacg atggcatcgc ctggccgaat gctctgtcca
    10981 ttgattactt cacggatcga atttactggg cagatgctca cttggactac atagcatatg
    11041 ctgatctgga gggcagacat cgtcatacgg tgctctcagg aagcaaggtg cctcatgtgt
    11101 tcgcactgag tctcttcgac gactacatct actggagtga ctggaattta aaggcgatcg
    11161 tgagggccaa caagttccat ggtgcgaact atacggtgct gaggaatacc acccatcgac
    11221 cgtatgacct gcacatcaat catccgctga gacagttgcc ctacaccaat ccgtgtggca
    11281 caaacaatgg cggttgctca catctctgcc tgattgctcc gccgccggaa tccacctatc
    11341 tgaacatcga gggatatatc gaggagggtg caccaatctt caagtgtgcc tgtcccaatc
    11401 aattctattt ggccagagac atgaagacct gcgtggccaa ctgtacggcc ggacagcatt
    11461 tgtgtggcgg acgagatgag aagtgcatcc catggttctg gaagtgcgac ggtgagaagg
    11521 actgcaagga tggctccgat gagcccgcta cctgcgctcc tcgacactgc cgtgctggaa
    11581 cgttccagtg caagaacacc aactgcacac catcggcgac catttgcgat ggagtggatg
    11641 actgtggcga tcgcagcgat gaacaaaatt gcgatctacc ctgtccacta tccgatttca
    11701 agtgcaagtc cagcggcaga tgcatcctcg atagttggcg ctgcgatgga gatgccgact
    11761 gcaaggatgg cagcgatgag gatccagccg tctgcttcaa gcgaacatgt gatccgaaaa
    11821 ccgagttctc ctgcaagaat ggccgctgca ttccgcaatt gtggatgtgc gatttcgaca
    11881 acgattgtgg cgacgactcc gatgagccgg cgtatatgtg ccgtcaaagg aactgcacca
    11941 ccggctggca gaggtgtccc ggccagtcca actatcgctg cattccgaag tggctgttct
    12001 gcgatggcaa ggacgattgt cgcgacaaca gcgatgagct gcccgagaac tgtcccaagt
    12061 gcaatccgga aacggacttc aagtgcggca acaaccgatg catacccaag caatggatgt
    12121 gcgatttcgc ggacgattgt ggcgatgcca gtgacgagaa tgaggcagtg tgcaaaggac
    12181 gctatcggga gtgctccgaa tcggagttcc gttgcggcaa tggcaagtgc atatcatccc
    12241 gctggcagtg tgaccacgag gacgactgtg gcgataactc ggacgagatg cactgcgagg
    12301 gataccagtg caagaatggc accttccagt gcgcttccgg tcactgtatt gcctcctact
    12361 tccggtgcga tggcgatcgc gactgccgcg acatgtccga tgaggtgggc tgtccgccca
    12421 gattccccgg cggtcgctat tgtcctgaat cgcgtttcca gtgcaacaac aacctgtgcg
    12481 tttcgctgtc cgatttgtgc gacggcaccg atgattgcgg cgatggcagt gacgaggatc
    12541 ccagcgtttg cagtgacttt aactgcgata ccctgcgacg attccagtgc tccaatgagc
    12601 gctgcgtggc ccgctatcag atctgcgatg gcgtggacaa ctgcggcgat ggcagcgatg
    12661 agaacaacat gaccctatgt gccagcaaac agaagccctg cgatctgtac acgcagtacc
    12721 agtgtgccaa caagcattgc atcgagcggt cccaggtgtg tgatttctcc gacgattgtg
    12781 gcgatgctag tgatgagtta ggatgccacc acacgagcag ttgctccgaa gcgaatcggg
    12841 gtggatgcca gcagcattgc cacaatctaa cggatggtgg atacatttgc acctgctatc
    12901 cgggctacat catagccgcc gacaacaaga agaagtgctc cgacgtggac gaatgcctga
    12961 cgcgacagca cacgtgctcc caccaatgcc acaatctgaa tggcacctac tcgtgcagtt
    13021 gtcgcgaagg attccatctg acggacggcg ccagcggcgt atgccgtgcc gaaaaggagg
    13081 atgtcattct cctgtttgtt aatggtcagg agatcagagg tctgaattgg cataagagcg
    13141 aggagttcgc tgtgatagcg gcggagaaga ggatcgaggc actggactac gatgcgcagc
    13201 aacagatcgt cttctgggcg gatagctatg acaagaccat caagcgatcc tacatggtca
    13261 atgccatcga tggcagggcc aagatcggat tcgcccagga cctgaacatg aagggcggct
    13321 cgaagcccac tgctgtggct gtggactggc tggcctcgaa tctctactgg accgaaatgg
    13381 acaggacggg ctcgaagccg cgtggacgtg tcatggtggc caagaccgat ggtcgctatc
    13441 gtcgctcgat cgtgaatgct ggactcgagg tacccacctc gattgctgtg aatccgcagc
    13501 tgggcagaat atactggtcg gatgcgggat cagctcccaa aatcgaggta tcctggatgg
    13561 atggctctaa gcgccgccca ctgatcaccg agatgatacg acatcccgcc ggcctgacca
    13621 tcgactactc gcaggatcac atcatatact gggtggacac caagctgaat gccatcgaat
    13681 cgatgagagc cgacggctcg cgccgaaagg ccattgtgcg gggcgatcaa ctgaggcatc
    13741 cggtgtctct ggatctcttc gagtcgaaca tgttctggat gacccgcgat acgggtgagc
    13801 tggtgcgcca ggataagttc gggcgcggag tgcaggtggt gctgcatcgc tatatcgtca
    13861 atccgtccgg cctgaaggtg taccacgaca agcggtacaa cacctcgctg cccaatccgt
    13921 gcgacaactc cacctgctcc cacctgtgcc tgctggtgcc gggcggccat cgttgtgcct
    13981 gtccagacgc ctctggaccg ccgccctcgc accgcagcac cgccgaggtc atctgcaatg
    14041 ctgccgccga gcatccgcgc ccggctccgc gaatctgccc ctgccagaat ggtggactct
    14101 gcaaggagga cgcccagggt gaactgctgt gcgagtgccg aacccagttc gttggcgagc
    14161 actgcgagac aagcacgatg ggagcctttg gccatggtga cgctaatgtc accgccgtcg
    14221 tggtgcccat catggtcatc ctgctggtga tgatggccgc cgctggcgcc tggtatgtca
    14281 tccgcaagcg accatttggc aagctggctc gcatgccggc gatgacctcg tcgcagagcg
    14341 tgaccttccg tcacggttcg aatgtggagt tcaacgagag cggcttccca ggagcatctg
    14401 cgccgggagc tggcgatgtg gcgcccatcg agggctacaa cctgcagacg gtgaacgcga
    14461 acaaggcgcg cgactttgcc aatcccatgt acgatgcagt ccaatcgggc accaccgccg
    14521 atccgggcat gggcaatggt tcgggcattt atgatgtgcc cggcgagccg tcggccaagg
    14581 tcaagtccat gggccaccat gcgggcggtt cgttcacgga acccgcctcg gcgatcatcg
    14641 cgcccagcag cattacgcac aaggcgtcgc cgcagctgca gctgcgcacc agggagctag
    14701 atccttcggc ggacaccggc aaggacacgc agttcctggt ggaggaggat aagtccgagt
    14761 gctgatatca agcccgtcaa tcggctgtcg ttgcggcggc agttgcgatg gccagttgcc
    14821 gccaacagcg ccggcagcat cagcagcagc agcatcccga gaacagctat ccgctgcaga
    14881 cataacacat actggtcaag cagaggaggg agcagcatca gaagcagcag catcagcaac
    14941 agcagcaaca tcagcagcag ggacagggac gttctagtag taaacatcac aaatcctggc
    15001 aggtagccac cgctggcaag gtcaccacca aggtctagcc gtgaccccaa cagaaaacac
    15061 acaccaccca cagagagtag caacacgatc aggaggagaa gatgcaggag gaggaggaga
    15121 aggatcagca gaaggaggag tagcaagtcc tcggggactg gggacgccaa taagcaaaca
    15181 tatccaaaaa ttgataaaca tatgcaaccc cccacaggag aaaccaact