Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_132218 1155 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_132218 VERSION NM_132218.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1155) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1155) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1155) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1155) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1155) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1155) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1155) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1155) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1155) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1155) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1155) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1155) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1155) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1155) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1155) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1155) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1155) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1155) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_132218.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1155 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1155 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /map="7D14-7D14" /db_xref="FLYBASE:FBgn0030005" /db_xref="GeneID:31737" CDS 49..996 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="CG2120 gene product from transcript CG2120-RB; CG2120-PB" /codon_start=1 /product="uncharacterized protein" /protein_id="NP_572446.2" /db_xref="FLYBASE:FBpp0290136" /db_xref="GeneID:31737" /db_xref="FLYBASE:FBgn0030005" /translation="MRSIDPVSQMANATLADDDLGNYDVCLEDLQLFAQLEDLSGERL PMEMELLNPGSEYDLLELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCD ICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDIC GKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEH PLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSAS ELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVHER" misc_feature 349..411 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(364..366,370..372,376..378,382..387,394..399, 406..408,448..450,454..456,466..471,478..483,490..492, 532..534,538..540,544..546,550..555,562..567,574..576) /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 433..495 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 499..>840 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="FOG: Zn-finger [General function prediction only]; Region: COG5048" /db_xref="CDD:227381" misc_feature 517..579 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 601..666 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 751..813 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(766..768,772..774,778..780,784..789,796..801, 808..810,856..858,862..864,874..879,886..891,898..900, 940..942,946..948,952..954,958..963,970..975,982..984) /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 835..903 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 925..987 /gene="CG2120" /locus_tag="Dmel_CG2120" /gene_synonym="Dmel\CG2120" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 cgtcagttgg ccaaacaaca gcagtccgaa cggaagcgga ggaccatcat gcgatccata 61 gatcccgtat cccaaatggc aaacgccact ttggcggacg acgatctggg taactatgac 121 gtttgcctcg aggatttgca actgtttgcc caactggagg atctctccgg agaaagattg 181 ccaatggaga tggagctgct gaatccgggc tcggaatacg atctattgga acttgtgaat 241 ggggctctcc agcagcgaaa caccacggaa cataagccaa cagacatgtg caagcccaag 301 cggacaccaa ccactaaacg ccaccgaaca actggcaagg atcacacctg cgacatatgc 361 gacagaagat tctcggaagc ctacaatctg cgcatccaca agatgacgca cacggacgag 421 aagccgcatg tgtgcgtgga gtgcggcaag ggattccggc aactgaacaa gctacgcatc 481 catgcagtga cccacacggc ggagcggcca cacaaatgtg atatctgcgg caagggtttc 541 cggtatgcca actacctaac tgtccatcga cgcttgcata cgggagagaa accatatcca 601 tgtttggcca ccgactgtca tctctccttt cattccatcc acgcgcggcg cattcacaca 661 aagctaaggc atgcggcaca aacggatccg gatcccgaac atccgctggc ggagcaagag 721 caacgggata catctgcgct cagcttcacc tgcccggttt gcagccgggt cctaacggat 781 cagtgctatc ttagcatcca cctgaagcgg cactacaatc agcgcgactt cccatgccca 841 cagccggagt gcggcaagag attctttagt gcctcggagc tgaagcacca ccagattgcc 901 cacacccagc agcgaccatt tgcctgtcca ctctgtccag cacgatttct gcgcaaatcc 961 aatcataagc aacacctcaa ggtgcacgag cgttgacagc tcgagagcac tttgattatg 1021 ttagtatacg gtacgatttc cctgtccatt cgaatcgaat tccaggcgaa tccgagactc 1081 gccccaccct aagctgcccc ccggaagggg gcttggtctg cgctttccat tcaatataag 1141 tgtttattta tatat