Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_132191 1668 bp mRNA linear INV 26-DEC-2023 (dpr14), transcript variant A, mRNA. ACCESSION NM_132191 VERSION NM_132191.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1668) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1668) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1668) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1668) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1668) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1668) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1668) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1668) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1668) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1668) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1668) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1668) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1668) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1668) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1668) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1668) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1668) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1668) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On May 8, 2012 this sequence version replaced NM_132191.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1668 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1668 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="defective proboscis extension response 14" /map="7C2-7C2" /db_xref="FLYBASE:FBgn0029974" /db_xref="GeneID:31702" CDS 477..1499 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="CG10946 gene product from transcript CG10946-RA; CG10946-PA; dpr14-PA" /codon_start=1 /product="defective proboscis extension response 14, isoform A" /protein_id="NP_572419.1" /db_xref="FLYBASE:FBpp0071086" /db_xref="GeneID:31702" /db_xref="FLYBASE:FBgn0029974" /translation="MRSRLFWILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNF WQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQ GKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQ VSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYIT WRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVV VHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSISVAGMNRGLGLGQVWGW GWELRR" misc_feature 717..1001 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 750..764 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 789..803 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 900..914 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 942..959 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 978..989 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1047..1313 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1077..1091 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409473" misc_feature 1116..1136 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409473" misc_feature 1218..1232 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409473" misc_feature 1260..1277 /gene="dpr14" /locus_tag="Dmel_CG10946" /gene_synonym="CG10946; CT30653; Dmel\CG10946; Dpr-14; Dpr14" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409473" ORIGIN 1 attcccgttt attggccatc cgagcagcag ttgcaaaagg ataaatacac acgcaacacg 61 agctggttaa taagcgcttt tccgattttc caattgtccg acattcctat ccctccagcc 121 tccatccgcg cgctgaaaag tgtgcaaaga aatcaacaaa aaagagaaaa agaaaaagta 181 aatatacata tataatcgaa aaggacactc tgaaaaagaa gatacttgag tgcaatatgt 241 ccagcaatat tttgccgcag ggcaatcgat aagcgaagcg aagtgaagtc cgtggaatca 301 tcgctggcga tgcagtggga cgctgatgca gttggacttg gatcgatata gaacagttta 361 gaggggcgtt cgttcatatg tgcatatcct gcggcgagtg gcgccagtcg atgcatcatc 421 ccgcatcctg ttaccgtatc ccgtaagtcg gcatatgaag acactccgct gcagtgatga 481 gatcgaggct gttttggata ctggcgatta tatactcctc actccatcac atcggctcgg 541 gttccacgtc gaccacattg aaacgaccgc gagctggcga tccattcgac acgtttccga 601 agaacttctg gcaggagttc tcatcgccgt tcaccgacac gcccgaggat gaggagctgg 661 aggtcaccga gacgaccacc cacgagccgt tcccgttctt cgccgatccg tacaccacgc 721 tgaacatcag cacccagctc tcgtccagcg tttatctgca ctgccgggtg aacgatctgc 781 agggcaagac ggtgtcctgg atgcgtcgcc gtggcgatga tctcaccctg ataacctttg 841 gccagcacac atatagcggc gactcgcggt attcgctgga gttcgaggag cccaacgatt 901 ggaagctgct catccagttc gccaacgagc gggacgaggg tccctacgag tgccaggtgt 961 cctcgcatcc gccgctcgtc ctgctcgttt accttactat aattgttcct cacgtggaga 1021 tactcgacga gcggggctcg gccacgccgg agaagtacta caaggctggc agcaccatcg 1081 agctgcagtg cgtcatttcg aagattccgc atccctcctc ctatatcacc tggcggcacg 1141 gaccgcgcct gctcaactac gatactagtc gcggaggaat cagtgtcaag acggacatgc 1201 tgccaggacg agctctgagt cgcctgtata tcgccaatgc caatcgccag gacacgggca 1261 actacacctg catgctgggc aatgagatta cggagacggt ggtggtgcat gtgctgaacg 1321 gtgaggagcc agccgccatg cagcatgcga acggaagccg ccaaaaggcc aacgcctcca 1381 caatggttgt gttatttcta gtgtacgttt gcatctccgg ttcgatttcc gtagccggaa 1441 tgaatcgggg attgggcttg ggacaagtgt ggggatgggg atgggaatta agacgatgac 1501 gacgcagcct aatccgggga tcgtagatcc tagattgtgt cgcgggaaat gcatatacca 1561 aaagagtctt gtccaggatt gcattttcga cttttactct aatcatgggt tgtttaacat 1621 acgatacata gcataaaccg aatattaagc ttaaggtcaa gtgtattt