Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_130565 1564 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_130565 VERSION NM_130565.4 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1564) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1564) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1564) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1564) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1564) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1564) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1564) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1564) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1564) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1564) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1564) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1564) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1564) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1564) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1564) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1564) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1564) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1564) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_130565.3. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1564 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1564 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /map="2A4-2B1" /db_xref="FLYBASE:FBgn0025382" /db_xref="GeneID:31103" CDS 779..1471 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="CG14791 gene product from transcript CG14791-RC; CG14791-PC; Rab27-PC" /codon_start=1 /product="Rab27, isoform C" /protein_id="NP_569921.1" /db_xref="FLYBASE:FBpp0070281" /db_xref="GeneID:31103" /db_xref="FLYBASE:FBgn0025382" /translation="MTGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKS FLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSA CTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPEDLVRLHDRR EEPCSRRNCRNC" misc_feature 800..1321 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab GTPase family 27a (Rab27a); Region: Rab27A; cd04127" /db_xref="CDD:206700" misc_feature 800..817 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206700" misc_feature 830..853 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="G1 box; other site" /db_xref="CDD:206700" misc_feature order(839..856,1166..1168,1172..1174,1256..1261) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206700" misc_feature order(854..886,899..904) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206700" misc_feature order(884..886,899..925) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Switch I region; other site" /db_xref="CDD:206700" misc_feature order(899..901,911..934,965..967,971..973) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206700" misc_feature 905..907 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="G2 box; other site" /db_xref="CDD:206700" misc_feature order(908..910,914..922,977..979,983..985,1004..1009, 1016..1018,1028..1030,1034..1045) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="putative effector interaction site [active]" /db_xref="CDD:206700" misc_feature order(908..913,917..919,983..988,1007..1009,1013..1015, 1019..1027) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206700" misc_feature 908..922 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206700" misc_feature 971..985 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206700" misc_feature 986..997 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="G3 box; other site" /db_xref="CDD:206700" misc_feature order(995..997,1001..1033) /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Switch II region; other site" /db_xref="CDD:206700" misc_feature 1004..1021 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206700" misc_feature 1028..1042 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206700" misc_feature 1055..1072 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206700" misc_feature 1124..1156 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206700" misc_feature 1163..1174 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="G4 box; other site" /db_xref="CDD:206700" misc_feature 1253..1261 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="G5 box; other site" /db_xref="CDD:206700" misc_feature 1301..1321 /gene="Rab27" /locus_tag="Dmel_CG14791" /gene_synonym="18543235; AAF45634; AAF45635; CG14791; dm-Rab27; Dmel\CG14791; DmRab27; EG:80H7.4; O76901; rab27" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:206700" ORIGIN 1 aatttgattg ctgaacacta ggattataga aacagtggac tattcgagca cgggatacac 61 tcctgacttt gaagccttcg tcggagagca aagcttaggc gccgtcccgc ggaagctccg 121 tccaaagccg ttccattctt aaagttgccc gagggattat gtctcgagag tgcttcgaag 181 tactcacgaa ataaccacgt tcccgtggga aaggacacct gtgcggcgca cctgtcgcgc 241 gcggaagcgc ttgaaagctg gcgcaagctt tggctgaaag ctgagcctcg gaaaagggac 301 tgcctgttgg cggccaacga gccctgtagt ctgtgctggg cagcgcatgg caacaggtcg 361 ggcagcgcac cgcccagagg atccactgcg ttgcatccgc agcatccgca cagcctcgga 421 gttttcgaag tcctcgtggg tcgcttgttt tcgtttagca aacctctgca aggtggttga 481 aggtcccttc ccccgcgcgg acgaattgcg cgcgctaaaa ataacggttg cccgcccagt 541 cagtctggtc cagtcagctg aatcgcagat tccttccaga tccttggagt gacgagtggc 601 gtgcggcgtg ccgaaagaag ccgccttggg cgccaaagtc gacggcgggc gtcggagcag 661 aaatgcgtgc cgcgcctcct gagcctgagc ctctgcaatt agccggatcc ggtgaacagg 721 cggacgggat gcgtctgcgg tcctgaacgt tccaaacgcg ctgctacgaa cggccattat 781 gacgggcgcc aacatcgact acgattacct gctcaagttc ctcgtcctgg gcgactccgg 841 cgtgggaaag acctgtctcc tctaccagta cacggatggc cggttccaca cccagttcat 901 ctccactgtg ggcatcgact tccgcgaaaa gcggctgctg tacaactccc gcggacgccg 961 ccaccgcatc cacctgcaga tctgggacac cgccggacag gagcgcttcc gttcactaac 1021 cacggcgttt taccgcgacg ccatgggttt cctgctcatc ttcgacctga ccagcgagaa 1081 gagcttcctg gagacggcca actggctgtc gcagctgcgg acgcacgcct actccgagga 1141 ccccgacgtg gtcctctgcg gcaacaagtg cgacctgctg cagctgcgcg tggtgagtcg 1201 cgaccaggtg gcggccctct gccgacgcta ccggctgccg tacatcgaga cgagcgcctg 1261 caccggcgcc aacgtcaagg aggccgtgga gctgctggtt ggccgggtca tggagcggat 1321 cgagaacgcg gcctgcaacc gcgagttctc cctgctactg acccagtcgc gatgcctgcc 1381 gaacatcgcc tacggtcagc cggaggacct ggtgcgcctc cacgatcggc gagaggagcc 1441 ctgctcgcgg cgcaactgcc gcaactgtta ggtgccatgc ccgtggccaa gtcaccctgc 1501 tttgttcctt gactcgtgtt tccgaatcta agtgtgtttc gctgtaaata aatgttgatt 1561 gttg