Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_130540 1487 bp mRNA linear INV 26-DEC-2023 A (CG11398), mRNA. ACCESSION NM_130540 VERSION NM_130540.4 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1487) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1487) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1487) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1487) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1487) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1487) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1487) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1487) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1487) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1487) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1487) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1487) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1487) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1487) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1487) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1487) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1487) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1487) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_130540.3. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1487 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1487 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /map="1E4-1E4" /db_xref="FLYBASE:FBgn0040366" /db_xref="GeneID:31070" CDS 79..1068 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="CG11398 gene product from transcript CG11398-RA; CG11398-PA" /codon_start=1 /product="uncharacterized protein, isoform A" /protein_id="NP_569896.1" /db_xref="FLYBASE:FBpp0070240" /db_xref="GeneID:31070" /db_xref="FLYBASE:FBgn0040366" /translation="MTEVQYKEAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQ GGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVD HMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECD QHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDV HLFVHSICKAYICSVCGADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAKNRSQ RSAIDESQDEELQWLKGVDALDSAGYLENSQFSNTGKMTAIFAEDENESELFN" misc_feature 232..294 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 337..399 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(352..354,358..360,364..366,370..375,382..387, 394..396,436..438,442..444,454..459,466..471,481..483, 529..531,535..537,541..543,547..552,559..564,571..573) /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 421..486 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 508..573 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 601..663 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(616..618,622..624,628..630,634..639,646..651, 658..660,700..702,706..708,718..723,730..735,742..744, 784..786,790..792,796..798,802..807,814..819) /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 685..747 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 769..819 /gene="CG11398" /locus_tag="Dmel_CG11398" /gene_synonym="Dmel\CG11398; EG:BACR42I17.11" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 gcgttagtac attcgggtga agagtatgta aaaatcaaaa caacataaac taatgtgttt 61 taatttgatt attctcaaat gactgaagta caatataaag aggccgagat cttggctcta 121 ctaccacata catatgagga tgaggagctg tccttaaaca cagaagagct acagttcgag 181 gaactcaatg agagaagcca gcaccagcaa ggcggatctc cgtccttcgt ctgcagacgc 241 tgtccagcgc tattcctcac cagggaggag ttggccgccc atcggcccac acaccgatac 301 cagggtggac agcaaacgcc cgcgtcggag catgcctgcg acgcgtgtgg aagggtcttc 361 caaaagcaca acgcccttgt ggatcacatg aatgcccaca acgacgtgcg gaactatccg 421 tgtcccgagt gtccggcgcg ctttgtgcag cgcagcaata gggagtgtca cctgaagaac 481 gttcatcgga aggtgtacct gcactcctgt ccagaaccgg gctgcaagaa gcgtttccag 541 cagaggcggg agtgtgatca gcatgtgaag acggtccacc agaatgagcg gaacctcgtt 601 tgcgacacct gcagtgcccg cttcagccat cctgtaaatt atagaaagca cttggcgtcc 661 catggctccg cgaagagcta cggctgtccg atctgtggaa agctcttcgg acggcccgaa 721 aacagggatg ttcatctctt cgtccatagt atctgtaagg cctatatatg ctccgtctgc 781 ggagcagatt atatgcggcg caatcagttg atacgccatg gcttggccag tggccaccac 841 aacgatccga ttgtccgcca aaaaccgcag tttagtccgg cccttgctgc gaagaatcga 901 agccagagaa gcgcaataga cgagtcccag gacgaggagc tccaatggct gaaaggagtt 961 gacgccctcg acagcgcagg atacctggag aattcacaat tttcgaacac cggcaagatg 1021 actgccatat ttgcagagga cgaaaacgaa agcgagttat tcaattgaat atgcattgag 1081 taagaagtac cagcagtgtg gtattgacca tctaggtgct taatcagcat actaagtagg 1141 aacagcttag ttcgaatgaa aaaacgaatg taattgtaaa tatgaaaact gaacaattag 1201 gtcataataa ttagcaatat ttacttagat atctatactg cattatatgt agatgtacat 1261 atgtatctat tgtacggaaa gagtcgaaaa ctgaaaaatt gaatctacag acttggcttt 1321 ggcagaaaac gccattaatt aatgaatgat aacatgcaaa aatgattacc gcatgcaaaa 1381 catgaaccgg agacgtcggt caaaaagtaa caacacaaca aagaaatgaa tgaaaagtga 1441 atgtcgctgc tgctcttgca ctttaataaa aaatgtgaaa tgaaatg