Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_078569 6736 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_078569 VERSION NM_078569.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 6736) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 6736) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 6736) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 6736) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 6736) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 6736) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 6736) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 6736) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 6736) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 6736) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 6736) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 6736) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 6736) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 6736) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 6736) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 6736) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 6736) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 6736) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_078569.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..6736 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..6736 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="RNA polymerase II subunit A" /map="10C6-10C6" /db_xref="FLYBASE:FBgn0003277" /db_xref="GeneID:32100" CDS 361..6024 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /EC_number="2.7.7.6" /note="CG1554 gene product from transcript CG1554-RA; CG1554-PA; Polr2A-PA; RNA polymeraseII-215 kd subunit; Pol II large subunit CTD; Pol II CTD; RNA Pol II; RNA polymerase II largest subunit; RNA polymerase IIo; polymerase II CTD; RNA-polymerase II; RNA polymerase II large subunit; Ultrabithorax-like; RNA polymerase II 215kD subunit" /codon_start=1 /product="RNA polymerase II subunit A" /protein_id="NP_511124.1" /db_xref="FLYBASE:FBpp0073387" /db_xref="GeneID:32100" /db_xref="FLYBASE:FBgn0003277" /translation="MSTPTDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETME GGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKI LRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTK ENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILK HITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDII KANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKAR LKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNID RMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIF NRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVE NIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKM PQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEH GELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIG DTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDA RDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRT LPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRL IKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKF DWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGESKVVLP CNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENAT LLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLG EPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKA KNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLL RIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQ DEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEF KAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVL QFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAA HAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFI GGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPSWSPA HPGSSPSSPGPSMSPYFPASPSVSPSYSPTSPNYTASSPGGASPNYSPSSPNYSPTSP LYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPG NAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPS YSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQY SPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPT SPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPTFEESED" misc_feature 403..2964 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Largest subunit (Rpb1) of eukaryotic RNA polymerase II (RNAP II), N-terminal domain; Region: RNAP_II_RPB1_N; cd02733" /db_xref="CDD:259848" misc_feature order(424..426,436..438,445..450,589..597,601..603, 634..636,1084..1086,1090..1092,1096..1098,1111..1116, 1288..1290,1351..1353,1360..1365,1372..1374,1393..1395, 1402..1404,1408..1431,1444..1452,1486..1488,1495..1500, 1705..1707,1711..1713,1717..1719,1729..1734,1738..1743, 1774..1779,1783..1785,1792..1794,1819..1830,1834..1836, 1840..1842,1846..1848,1855..1860,1867..1869,1876..1881, 1888..1893,1906..1908,1951..1956,1963..1965,2374..2379, 2641..2643,2656..2661,2674..2676,2683..2688,2713..2718, 2806..2811,2815..2823,2830..2835,2842..2847,2851..2859, 2866..2871,2875..2880,2917..2922,2929..2931,2941..2943) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="RPB1 - RPB2 interface [polypeptide binding]; other site" /db_xref="CDD:259848" misc_feature order(424..465,478..480,595..672,1069..1128,1240..1260, 1267..1293,1348..1398,1402..1416) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="clamp; other site" /db_xref="CDD:259848" misc_feature order(478..492,583..585,1120..1122,1126..1128,1144..1161, 1165..1173,1177..1182,1189..1191,1201..1203,1249..1251, 1258..1263,1270..1275,1300..1317,1324..1341,1345..1347, 1360..1362,1375..1377,1588..1590,1597..1599,1609..1620, 1624..1632) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="RPB1-TFIIB interface [polypeptide binding]; other site" /db_xref="CDD:259848" misc_feature order(559..561,568..570,589..591,598..600) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Zn-binding [ion binding]; other site" /db_xref="CDD:259848" misc_feature order(658..663,1372..1374,1387..1389,1408..1410, 1426..1428,1714..1722,1819..1821,1825..1827,1831..1833, 2908..2913) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="active site region [active]" /db_xref="CDD:259848" misc_feature 3028..3573 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="RNA polymerase Rpb1, domain 6; Region: RNA_pol_Rpb1_6; pfam04992" /db_xref="CDD:461511" misc_feature 3508..4764 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain; Region: RNAP_II_Rpb1_C; cd02584" /db_xref="CDD:132720" misc_feature order(3565..3570,3580..3582,3589..3591,4738..4740, 4747..4758,4762..4764) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Rpb1 - Rpb6 interaction site [polypeptide binding]; other site" /db_xref="CDD:132720" misc_feature order(3580..3672,3676..3768,3784..3828,4234..4236, 4264..4293,4297..4299,4312..4497,4504..4563,4567..4611) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="cleft [active]" /db_xref="CDD:132720" misc_feature order(3592..3594,3601..3603,4204..4206,4216..4218, 4654..4656,4684..4692,4708..4713,4717..4719,4723..4725, 4738..4740) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Rpb1 - Rpb2 interaction site [polypeptide binding]; other site" /db_xref="CDD:132720" misc_feature order(3727..3729,4582..4584,4633..4638,4645..4647) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:132720" misc_feature order(4378..4380,4396..4401,4405..4407,4435..4455, 4459..4461,4519..4521,4552..4557,4561..4563) /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Rpb1 - Rpb5 interaction site [polypeptide binding]; other site" /db_xref="CDD:132720" misc_feature 4609..4734 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="clamp [active]" /db_xref="CDD:132720" misc_feature <4852..5946 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="Herpes virus major outer envelope glycoprotein (BLLF1); Region: Herpes_BLLF1; pfam05109" /db_xref="CDD:282904" misc_feature <5479..6000 /gene="Polr2A" /locus_tag="Dmel_CG1554" /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2]; Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II; Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215; RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0; RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2; RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215; Rpll215; RPO21; Ser5-P Pol II; Ubl" /note="104 kDa microneme/rhoptry antigen; Provisional; Region: PTZ00449" /db_xref="CDD:185628" ORIGIN 1 ctgcagtcac acttttcggt cggcgttgtc cgcattttca catcgcatcg cgtctgaaaa 61 aacgggctaa ttcgcattcg caatcgcctg tagggcccga ctggtataga atgcacgccc 121 agcgtgccag caacaaacag tgattgttta cccagccttc tatttgggct ttcgcgtttt 181 tcgagctcct tcttttccct tcccggtcgt atcccttgcc ttttgcacga ggtgaaaagt 241 gtgacgacgc agcagaaaaa gcaaaagcaa aaaaaaggtg gaacaaaaaa aaaccgcaca 301 cacacaccga aagcaggctc cactttggtc tagtggccac cagtatcgct gacgaccagg 361 atgagcaccc ccacggactc gaaggcgccg ttgcgccagg tgaagcgcgt acagttcggc 421 attttgtccc ctgatgaaat tcgtcgcatg tccgtcaccg agggtggcgt ccagtttgcg 481 gagacaatgg agggcggacg accaaagctg ggcggattga tggatccgcg ccagggtgtc 541 atagacagga cgtcgcgctg tcagacgtgc gccggcaata tgaccgagtg ccccggtcac 601 tttggacaca tcgacctggc caaaccagtg ttccacatcg gcttcatcac caagacaatt 661 aagattttgc gatgtgtgtg cttctactgc tccaaaatgt tggtctcgcc acacaatcca 721 aagatcaagg agatcgttat gaagtctagg ggacagccgc gtaagcgcct ggcctacgtc 781 tatgatctgt gcaagggcaa gacgatttgc gagggcggcg aggacatgga tctcaccaag 841 gagaaccagc agccggatcc aaacaaaaag cccggccacg gcggttgcgg tcactaccag 901 ccgtcgatcc ggagaacagg actggatctc accgccgagt ggaagcatca gaacgaggat 961 tcgcaggaga agaagatcgt ggtctcggca gagcgggttt gggaaatcct taagcatatc 1021 accgatgagg agtgctttat tctgggcatg gatcccaagt atgcgcgtcc cgattggatg 1081 atcgtgaccg tcctgcctgt tccaccgttg gccgtacggc cagcggtcgt gatgtttggt 1141 gctgccaaga atcaggatga tttgacgcac aagctgtccg atatcatcaa ggcaaacaat 1201 gagcttcgca agaacgaggc cagtggtgcc gcagcgcatg tgatccagga gaacatcaag 1261 atgctgcaat tccacgtcgc cacactagtg gacaacgata tgcccggcat gcccagggct 1321 atgcaaaagt cgggaaaacc ccttaaagcc atcaaggcgc gactcaaggg taaggagggt 1381 aggattcgtg gcaacttgat gggcaaacgt gtcgacttct ccgcccgtac tgtcatcaca 1441 cccgatccaa atctgcgtat cgatcaggtc ggtgtgccgc gttccattgc ccagaatcta 1501 accttccccg agctggtcac tcccttcaac atcgatcgca tgcaggagct ggtgcgcagg 1561 ggtaattcgc agtatccggg tgccaagtac attgtgcgcg acaatggcga gcgtattgat 1621 cttcgctttc atcctaaatc ctctgattta catctgcagt gcggctacaa ggtagagcgg 1681 catttgcgcg acgacgatct ggtgatcttc aaccgacagc ccacgctgca caagatgagt 1741 atgatgggtc acagggtgaa agtgttgccc tggtcgactt tccgcatgaa cctgtcgtgt 1801 acatcgccct acaatgctga tttcgacggc gatgaaatga atttgcacgt tccgcagtcc 1861 atggagacgc gcgccgaggt ggagaacatc cacatcacac ccagacagat catcacgccg 1921 caggcgaaca aacctgtcat gggtatcgtg caggacactc tgactgcggt gcgaaagatg 1981 accaagcgcg acgtattcat cacgcgcgag caggtgatga atctgctcat gttcctgccc 2041 acgtgggacg ctaaaatgcc gcaaccctgc atcctgaaac cgcgtcccct gtggacgggc 2101 aaacagatct tctccctgat catccccggc aacgtgaaca tgatacgcac acattccacg 2161 catccggacg aggaggatga aggaccatac aagtggatct cgcccggtga caccaaggta 2221 atggtggagc acggtgaact tatcatgggg atcctctgca agaagtcact gggtacatca 2281 gccggatcac tgctgcatat ttgtttcctg gaacttggtc acgatatcgc tggtcggttc 2341 tatggcaaca ttcagaccgt gatcaacaat tggttgcttt tcgagggcca tagtatcggt 2401 attggtgaca ctattgccga tccccagacc tacaacgaga tccagcaggc catcaagaag 2461 gcaaaggacg acgtgataaa cgttatccaa aaggcccaca acatggagct ggagcccacg 2521 ccgggtaata ctctgcgtca gacgttcgag aacaaggtga accgtatcct aaacgatgct 2581 cgtgacaaga ctggtggttc ggccaagaaa tctctcactg agtacaacaa tctaaaggct 2641 atggtggtgt ctggttccaa gggttccaac attaatatat cccaggttat tgcttgtgtg 2701 ggtcaacaga acgtggaggg taagcgaatc ccctacggtt tccgcaaacg cactcttccc 2761 cactttatta aggacgatta tggtcctgag tcgcgcggtt tcgtggagaa ttcgtatctt 2821 gccggcctga caccctctga gttctatttc cacgctatgg gtggtcgtga aggtcttatc 2881 gatactgctg taaagacagc tgaaaccggt tacatccagc gtcgtcttat aaaggctatg 2941 gagtcggtga tggttaacta cgacggaaca gtgcgtaact cggtgggcca gcttattcag 3001 ctgcgttacg gcgaggacgg tctttgcggc gagctggttg agttccagaa catgccaacg 3061 gtgaaactgt cgaacaagtc gtttgaaaag cgcttcaaat ttgactggag caacgagcga 3121 ttaatgaaaa aggtatttac ggatgatgtg atcaaggaga tgaccgacag cagcgaagcc 3181 atccaggaac tggaggcaga gtgggatcgt ttggtttccg atcgcgacag tttgagacaa 3241 atcttcccta acggcgaatc caaggtggta ctgccgtgca acctgcagcg tatgatctgg 3301 aatgtgcaga agatctttca catcaacaag cgcctgccca cggatctctc gcccattcgg 3361 gtgatcaagg gcgttaagac attgctcgaa cgctgtgtta ttgtcacggg aaatgatcga 3421 atttcaaagc aggccaacga gaacgccacg ttgctattcc agtgcctaat ccgttcgaca 3481 ctatgtacga aatacgtgtc ggaggagttc cgcctgtcca cagaggcgtt tgagtggttg 3541 gtcggagaaa tcgagacgcg tttccaacag gcccaggcca atcccggcga gatggtgggt 3601 gccctggctg cccagagttt gggtgagccc gctactcaga tgacactgaa caccttccat 3661 tttgctggtg tgtcttcaaa gaacgtaaca ttgggtgtgc cgcgtctcaa ggagattatc 3721 aacatatcca aaaagcccaa agcgccgtcg ctaaccgttt tccttactgg cggcgctgct 3781 cgcgatgcgg agaaggccaa gaacgtactg tgccgcctgg agcataccac gctgcgcaag 3841 gttacggcca atacggctat ttactacgac ccggatccgc agagaacggt gatatccgag 3901 gatcaagaat ttgtgaatgt ctactacgaa atgcccgact ttgatcccac acgcatttcg 3961 ccctggttgc tacgtattga attggaccgc aagcggatga cggacaagaa gctgacaatg 4021 gaacagatcg ccgagaagat taacgtgggc ttcggggagg atctcaattg tattttcaat 4081 gacgacaatg ccgataagct ggtgctgcgc attaggatca tgaacaacga agagaacaag 4141 ttccaggacg aagacgaggc cgtcgacaag atggaggacg acatgttctt gcgctgcatt 4201 gaggccaaca tgctgtcgga catgacactg cagggtatcg aagccatcgg caaggtgtac 4261 atgcatctgc cacagaccga cagcaagaag cgtatcgtga tcactgagac cggagagttt 4321 aaggccatcg gcgagtggct gctcgagacg gacggcacat cgatgatgaa agtgctgtct 4381 gagcgtgacg tggacccaat ccgaacatcc tccaacgata tttgcgagat attccaggtg 4441 ctgggcatcg aggcggtgcg aaagtctgtc gaaaaggaga tgaacgccgt gttgcagttc 4501 tacggcctgt acgtgaacta tcgtcacttg gccctgttgt gcgatgtgat gacggccaag 4561 ggccatctga tggccatcac ccgtcacggc attaacaggc aagacactgg tgcccttatg 4621 cgttgctcct ttgaggagac agtggatgtg ctaatggatg ccgccgctca cgccgaaacg 4681 gatcccatga ggggcgtctc tgagaacatt atcatgggac agctgcccaa aatgggtacc 4741 ggctgctttg accttctgct cgatgcagag aagtgtcgtt tcggcatcga gattcccaat 4801 acgttgggca acagtatgct aggtggcgcc gctatgttca ttggcggtgg atcgacaccg 4861 agcatgacgc caccgatgac gccgtgggct aactgcaaca cgccgcgata cttctctcca 4921 cccggccacg taagtgccat gactcctggc ggtcccagtt tctcgccttc ggctgcatcg 4981 gatgcgtccg gaatgtcgcc tagctggtcg ccggctcatc cgggctcatc gcccagttca 5041 ccaggacctt cgatgtcgcc gtatttccca gcctcgccga gtgtttctcc ctcttattcg 5101 ccaacgagtc cgaactacac ggcatcttct cccggtggag cctcgccgaa ttactcgccc 5161 tcgagtccga actattcgcc gacgtcgccg ctttatgcaa gtccacgtta cgcatcgaca 5221 acgccaaatt tcaatccaca gtcgacgggt tactcgccat cttcatcggg atactcgcca 5281 acatccccgg tctactcgcc cacggtgcaa ttccagtcga gtccgtcgtt tgcgggcagc 5341 ggtagcaaca tttactcgcc gggcaatgcg tactcgccca gctcgtccaa ctactccccc 5401 aattcaccat cctactcgcc gacatcacca tcgtactcgc cgtcaagtcc ttcgtactcg 5461 ccaacgtcgc cttgctattc gcccacatcg ccttcgtact cgccaacgag tccgaactac 5521 acacccgtaa caccctcata ctcgccgaca agtccgaact attcagcgtc gccgcaatat 5581 tctccagcct cgccagctta ctcgcaaacg ggggtgaagt actcaccgac atcgccgacg 5641 tactcgccgc cgtcaccatc gtacgatggg tctcccggat caccacaata tacgccagga 5701 tctccgcagt actcgccggc ctcgcctaag tactcgccga cctcaccgct gtactcgccc 5761 agctcgccgc agcactcgcc ctcaaaccag tacagcccaa caggatcgac ctattcggcg 5821 acgagtccgc ggtactcgcc gaacatgtcc atctactcgc cgagcagcac caagtactcg 5881 cccacctcgc caacgtacac accgacggcc cgcaactact cgcccacgtc accgatgtac 5941 tcgccaacgg ctccatcgca ctacagtccc acgagtccgg cctactcgcc cagcagtccc 6001 acgttcgagg agagcgaaga ctgaggaagg gaggacgggg gtagctcccc cagcacgtcc 6061 cgatctccgg ggcggtcaag ccgtagttaa gtaccgacta cgctcgatcg cccgaacggg 6121 aaaggtgaat ttaataatat tatgtttgta tacagcaaat aggtctctca tacaaaattc 6181 aatactgttt gcaaaagtag ctttaaacaa gttgtataaa ttagcctaca gtttcgtatt 6241 tggttttgtg gtaaagtaaa cattttgaat tgtttgcgtt aaccagaaaa gcgaattcga 6301 agccatttat atttgcacaa attgtttcaa gttgcaattc tcgaactgta ttcgataatg 6361 cgaatctatt tctttgcaca acccactgta tgaaattgtt tactaactgg aagactcttg 6421 tcactcttct gcaaagtact ttcacatttt tttgaatatc cctattctta ttttgcctaa 6481 tgttagtata aagaccctag ttattaaaaa caacaacaaa acaagccaac gtcagacact 6541 atttgtagcg ttttccatat accctttaaa tccctaatta acccgatcag ttgttttcgc 6601 ctgcacacaa atgttactta taaagcataa gaatgcaggc acccacccat acactacact 6661 atatattcat atatattttt acgtccgaca catttttgta aattatgaca gaaaacaaaa 6721 tagaaaatta taaaat