Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster RNA polymerase II subunit A (Polr2A), mRNA.


LOCUS       NM_078569               6736 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_078569
VERSION     NM_078569.3
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 6736)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 6736)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 6736)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 6736)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 6736)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 6736)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 6736)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 6736)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 6736)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 6736)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 6736)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 6736)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 6736)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 6736)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 6736)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 6736)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 6736)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 6736)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_078569.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..6736
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..6736
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="RNA polymerase II subunit A"
                     /map="10C6-10C6"
                     /db_xref="FLYBASE:FBgn0003277"
                     /db_xref="GeneID:32100"
     CDS             361..6024
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /EC_number="2.7.7.6"
                     /note="CG1554 gene product from transcript CG1554-RA;
                     CG1554-PA; Polr2A-PA; RNA polymeraseII-215 kd subunit; Pol
                     II large subunit CTD; Pol II CTD; RNA Pol II; RNA
                     polymerase II largest subunit; RNA polymerase IIo;
                     polymerase II CTD; RNA-polymerase II; RNA polymerase II
                     large subunit; Ultrabithorax-like; RNA polymerase II 215kD
                     subunit"
                     /codon_start=1
                     /product="RNA polymerase II subunit A"
                     /protein_id="NP_511124.1"
                     /db_xref="FLYBASE:FBpp0073387"
                     /db_xref="GeneID:32100"
                     /db_xref="FLYBASE:FBgn0003277"
                     /translation="MSTPTDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETME
                     GGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKI
                     LRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTK
                     ENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILK
                     HITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDII
                     KANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKAR
                     LKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNID
                     RMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIF
                     NRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVE
                     NIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKM
                     PQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEH
                     GELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIG
                     DTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDA
                     RDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRT
                     LPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRL
                     IKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKF
                     DWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGESKVVLP
                     CNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENAT
                     LLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLG
                     EPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKA
                     KNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLL
                     RIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQ
                     DEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEF
                     KAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVL
                     QFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAA
                     HAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFI
                     GGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPSWSPA
                     HPGSSPSSPGPSMSPYFPASPSVSPSYSPTSPNYTASSPGGASPNYSPSSPNYSPTSP
                     LYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPG
                     NAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPS
                     YSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQY
                     SPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPT
                     SPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPTFEESED"
     misc_feature    403..2964
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Largest subunit (Rpb1) of eukaryotic RNA polymerase
                     II (RNAP II), N-terminal domain; Region: RNAP_II_RPB1_N;
                     cd02733"
                     /db_xref="CDD:259848"
     misc_feature    order(424..426,436..438,445..450,589..597,601..603,
                     634..636,1084..1086,1090..1092,1096..1098,1111..1116,
                     1288..1290,1351..1353,1360..1365,1372..1374,1393..1395,
                     1402..1404,1408..1431,1444..1452,1486..1488,1495..1500,
                     1705..1707,1711..1713,1717..1719,1729..1734,1738..1743,
                     1774..1779,1783..1785,1792..1794,1819..1830,1834..1836,
                     1840..1842,1846..1848,1855..1860,1867..1869,1876..1881,
                     1888..1893,1906..1908,1951..1956,1963..1965,2374..2379,
                     2641..2643,2656..2661,2674..2676,2683..2688,2713..2718,
                     2806..2811,2815..2823,2830..2835,2842..2847,2851..2859,
                     2866..2871,2875..2880,2917..2922,2929..2931,2941..2943)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="RPB1 - RPB2 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259848"
     misc_feature    order(424..465,478..480,595..672,1069..1128,1240..1260,
                     1267..1293,1348..1398,1402..1416)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="clamp; other site"
                     /db_xref="CDD:259848"
     misc_feature    order(478..492,583..585,1120..1122,1126..1128,1144..1161,
                     1165..1173,1177..1182,1189..1191,1201..1203,1249..1251,
                     1258..1263,1270..1275,1300..1317,1324..1341,1345..1347,
                     1360..1362,1375..1377,1588..1590,1597..1599,1609..1620,
                     1624..1632)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="RPB1-TFIIB interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259848"
     misc_feature    order(559..561,568..570,589..591,598..600)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259848"
     misc_feature    order(658..663,1372..1374,1387..1389,1408..1410,
                     1426..1428,1714..1722,1819..1821,1825..1827,1831..1833,
                     2908..2913)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="active site region [active]"
                     /db_xref="CDD:259848"
     misc_feature    3028..3573
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="RNA polymerase Rpb1, domain 6; Region:
                     RNA_pol_Rpb1_6; pfam04992"
                     /db_xref="CDD:461511"
     misc_feature    3508..4764
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Largest subunit (Rpb1) of Eukaryotic RNA polymerase
                     II (RNAP II), C-terminal domain; Region: RNAP_II_Rpb1_C;
                     cd02584"
                     /db_xref="CDD:132720"
     misc_feature    order(3565..3570,3580..3582,3589..3591,4738..4740,
                     4747..4758,4762..4764)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Rpb1 - Rpb6 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132720"
     misc_feature    order(3580..3672,3676..3768,3784..3828,4234..4236,
                     4264..4293,4297..4299,4312..4497,4504..4563,4567..4611)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="cleft [active]"
                     /db_xref="CDD:132720"
     misc_feature    order(3592..3594,3601..3603,4204..4206,4216..4218,
                     4654..4656,4684..4692,4708..4713,4717..4719,4723..4725,
                     4738..4740)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Rpb1 - Rpb2 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132720"
     misc_feature    order(3727..3729,4582..4584,4633..4638,4645..4647)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132720"
     misc_feature    order(4378..4380,4396..4401,4405..4407,4435..4455,
                     4459..4461,4519..4521,4552..4557,4561..4563)
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Rpb1 - Rpb5 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132720"
     misc_feature    4609..4734
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="clamp [active]"
                     /db_xref="CDD:132720"
     misc_feature    <4852..5946
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="Herpes virus major outer envelope glycoprotein
                     (BLLF1); Region: Herpes_BLLF1; pfam05109"
                     /db_xref="CDD:282904"
     misc_feature    <5479..6000
                     /gene="Polr2A"
                     /locus_tag="Dmel_CG1554"
                     /gene_synonym="5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD;
                     DmCTD; Dmel\CG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca;
                     l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II;
                     Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol
                     II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[ser2];
                     Pol IIo[Ser2]; Pol IIo[ser5]; Pol II[ser2]; Pol-II;
                     Pol-IIa; polII; PolII; PolIIa; PolIIo; PolIIo[ser2];
                     PolIIo[ser5]; Poll II; PolR2A; RNA pol II; RNA Pol II; RNA
                     Pol II CTD; RNA Pol II ser2P; RNA pol IIo; RNA PolI 215;
                     RNA polII; RNA PolII; RNA PolII CTD; RNA-Pol; RNA-PolII;
                     RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII Ser5P; RNAPII0;
                     RNAPII[[0]][ser5]; RNAPoIIII; RNApol; RNApol II; RNApol2;
                     RNApolII; Rpb1; RPB1; RpII; rpII1; RpII215; RPII215;
                     Rpll215; RPO21; Ser5-P Pol II; Ubl"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
ORIGIN      
        1 ctgcagtcac acttttcggt cggcgttgtc cgcattttca catcgcatcg cgtctgaaaa
       61 aacgggctaa ttcgcattcg caatcgcctg tagggcccga ctggtataga atgcacgccc
      121 agcgtgccag caacaaacag tgattgttta cccagccttc tatttgggct ttcgcgtttt
      181 tcgagctcct tcttttccct tcccggtcgt atcccttgcc ttttgcacga ggtgaaaagt
      241 gtgacgacgc agcagaaaaa gcaaaagcaa aaaaaaggtg gaacaaaaaa aaaccgcaca
      301 cacacaccga aagcaggctc cactttggtc tagtggccac cagtatcgct gacgaccagg
      361 atgagcaccc ccacggactc gaaggcgccg ttgcgccagg tgaagcgcgt acagttcggc
      421 attttgtccc ctgatgaaat tcgtcgcatg tccgtcaccg agggtggcgt ccagtttgcg
      481 gagacaatgg agggcggacg accaaagctg ggcggattga tggatccgcg ccagggtgtc
      541 atagacagga cgtcgcgctg tcagacgtgc gccggcaata tgaccgagtg ccccggtcac
      601 tttggacaca tcgacctggc caaaccagtg ttccacatcg gcttcatcac caagacaatt
      661 aagattttgc gatgtgtgtg cttctactgc tccaaaatgt tggtctcgcc acacaatcca
      721 aagatcaagg agatcgttat gaagtctagg ggacagccgc gtaagcgcct ggcctacgtc
      781 tatgatctgt gcaagggcaa gacgatttgc gagggcggcg aggacatgga tctcaccaag
      841 gagaaccagc agccggatcc aaacaaaaag cccggccacg gcggttgcgg tcactaccag
      901 ccgtcgatcc ggagaacagg actggatctc accgccgagt ggaagcatca gaacgaggat
      961 tcgcaggaga agaagatcgt ggtctcggca gagcgggttt gggaaatcct taagcatatc
     1021 accgatgagg agtgctttat tctgggcatg gatcccaagt atgcgcgtcc cgattggatg
     1081 atcgtgaccg tcctgcctgt tccaccgttg gccgtacggc cagcggtcgt gatgtttggt
     1141 gctgccaaga atcaggatga tttgacgcac aagctgtccg atatcatcaa ggcaaacaat
     1201 gagcttcgca agaacgaggc cagtggtgcc gcagcgcatg tgatccagga gaacatcaag
     1261 atgctgcaat tccacgtcgc cacactagtg gacaacgata tgcccggcat gcccagggct
     1321 atgcaaaagt cgggaaaacc ccttaaagcc atcaaggcgc gactcaaggg taaggagggt
     1381 aggattcgtg gcaacttgat gggcaaacgt gtcgacttct ccgcccgtac tgtcatcaca
     1441 cccgatccaa atctgcgtat cgatcaggtc ggtgtgccgc gttccattgc ccagaatcta
     1501 accttccccg agctggtcac tcccttcaac atcgatcgca tgcaggagct ggtgcgcagg
     1561 ggtaattcgc agtatccggg tgccaagtac attgtgcgcg acaatggcga gcgtattgat
     1621 cttcgctttc atcctaaatc ctctgattta catctgcagt gcggctacaa ggtagagcgg
     1681 catttgcgcg acgacgatct ggtgatcttc aaccgacagc ccacgctgca caagatgagt
     1741 atgatgggtc acagggtgaa agtgttgccc tggtcgactt tccgcatgaa cctgtcgtgt
     1801 acatcgccct acaatgctga tttcgacggc gatgaaatga atttgcacgt tccgcagtcc
     1861 atggagacgc gcgccgaggt ggagaacatc cacatcacac ccagacagat catcacgccg
     1921 caggcgaaca aacctgtcat gggtatcgtg caggacactc tgactgcggt gcgaaagatg
     1981 accaagcgcg acgtattcat cacgcgcgag caggtgatga atctgctcat gttcctgccc
     2041 acgtgggacg ctaaaatgcc gcaaccctgc atcctgaaac cgcgtcccct gtggacgggc
     2101 aaacagatct tctccctgat catccccggc aacgtgaaca tgatacgcac acattccacg
     2161 catccggacg aggaggatga aggaccatac aagtggatct cgcccggtga caccaaggta
     2221 atggtggagc acggtgaact tatcatgggg atcctctgca agaagtcact gggtacatca
     2281 gccggatcac tgctgcatat ttgtttcctg gaacttggtc acgatatcgc tggtcggttc
     2341 tatggcaaca ttcagaccgt gatcaacaat tggttgcttt tcgagggcca tagtatcggt
     2401 attggtgaca ctattgccga tccccagacc tacaacgaga tccagcaggc catcaagaag
     2461 gcaaaggacg acgtgataaa cgttatccaa aaggcccaca acatggagct ggagcccacg
     2521 ccgggtaata ctctgcgtca gacgttcgag aacaaggtga accgtatcct aaacgatgct
     2581 cgtgacaaga ctggtggttc ggccaagaaa tctctcactg agtacaacaa tctaaaggct
     2641 atggtggtgt ctggttccaa gggttccaac attaatatat cccaggttat tgcttgtgtg
     2701 ggtcaacaga acgtggaggg taagcgaatc ccctacggtt tccgcaaacg cactcttccc
     2761 cactttatta aggacgatta tggtcctgag tcgcgcggtt tcgtggagaa ttcgtatctt
     2821 gccggcctga caccctctga gttctatttc cacgctatgg gtggtcgtga aggtcttatc
     2881 gatactgctg taaagacagc tgaaaccggt tacatccagc gtcgtcttat aaaggctatg
     2941 gagtcggtga tggttaacta cgacggaaca gtgcgtaact cggtgggcca gcttattcag
     3001 ctgcgttacg gcgaggacgg tctttgcggc gagctggttg agttccagaa catgccaacg
     3061 gtgaaactgt cgaacaagtc gtttgaaaag cgcttcaaat ttgactggag caacgagcga
     3121 ttaatgaaaa aggtatttac ggatgatgtg atcaaggaga tgaccgacag cagcgaagcc
     3181 atccaggaac tggaggcaga gtgggatcgt ttggtttccg atcgcgacag tttgagacaa
     3241 atcttcccta acggcgaatc caaggtggta ctgccgtgca acctgcagcg tatgatctgg
     3301 aatgtgcaga agatctttca catcaacaag cgcctgccca cggatctctc gcccattcgg
     3361 gtgatcaagg gcgttaagac attgctcgaa cgctgtgtta ttgtcacggg aaatgatcga
     3421 atttcaaagc aggccaacga gaacgccacg ttgctattcc agtgcctaat ccgttcgaca
     3481 ctatgtacga aatacgtgtc ggaggagttc cgcctgtcca cagaggcgtt tgagtggttg
     3541 gtcggagaaa tcgagacgcg tttccaacag gcccaggcca atcccggcga gatggtgggt
     3601 gccctggctg cccagagttt gggtgagccc gctactcaga tgacactgaa caccttccat
     3661 tttgctggtg tgtcttcaaa gaacgtaaca ttgggtgtgc cgcgtctcaa ggagattatc
     3721 aacatatcca aaaagcccaa agcgccgtcg ctaaccgttt tccttactgg cggcgctgct
     3781 cgcgatgcgg agaaggccaa gaacgtactg tgccgcctgg agcataccac gctgcgcaag
     3841 gttacggcca atacggctat ttactacgac ccggatccgc agagaacggt gatatccgag
     3901 gatcaagaat ttgtgaatgt ctactacgaa atgcccgact ttgatcccac acgcatttcg
     3961 ccctggttgc tacgtattga attggaccgc aagcggatga cggacaagaa gctgacaatg
     4021 gaacagatcg ccgagaagat taacgtgggc ttcggggagg atctcaattg tattttcaat
     4081 gacgacaatg ccgataagct ggtgctgcgc attaggatca tgaacaacga agagaacaag
     4141 ttccaggacg aagacgaggc cgtcgacaag atggaggacg acatgttctt gcgctgcatt
     4201 gaggccaaca tgctgtcgga catgacactg cagggtatcg aagccatcgg caaggtgtac
     4261 atgcatctgc cacagaccga cagcaagaag cgtatcgtga tcactgagac cggagagttt
     4321 aaggccatcg gcgagtggct gctcgagacg gacggcacat cgatgatgaa agtgctgtct
     4381 gagcgtgacg tggacccaat ccgaacatcc tccaacgata tttgcgagat attccaggtg
     4441 ctgggcatcg aggcggtgcg aaagtctgtc gaaaaggaga tgaacgccgt gttgcagttc
     4501 tacggcctgt acgtgaacta tcgtcacttg gccctgttgt gcgatgtgat gacggccaag
     4561 ggccatctga tggccatcac ccgtcacggc attaacaggc aagacactgg tgcccttatg
     4621 cgttgctcct ttgaggagac agtggatgtg ctaatggatg ccgccgctca cgccgaaacg
     4681 gatcccatga ggggcgtctc tgagaacatt atcatgggac agctgcccaa aatgggtacc
     4741 ggctgctttg accttctgct cgatgcagag aagtgtcgtt tcggcatcga gattcccaat
     4801 acgttgggca acagtatgct aggtggcgcc gctatgttca ttggcggtgg atcgacaccg
     4861 agcatgacgc caccgatgac gccgtgggct aactgcaaca cgccgcgata cttctctcca
     4921 cccggccacg taagtgccat gactcctggc ggtcccagtt tctcgccttc ggctgcatcg
     4981 gatgcgtccg gaatgtcgcc tagctggtcg ccggctcatc cgggctcatc gcccagttca
     5041 ccaggacctt cgatgtcgcc gtatttccca gcctcgccga gtgtttctcc ctcttattcg
     5101 ccaacgagtc cgaactacac ggcatcttct cccggtggag cctcgccgaa ttactcgccc
     5161 tcgagtccga actattcgcc gacgtcgccg ctttatgcaa gtccacgtta cgcatcgaca
     5221 acgccaaatt tcaatccaca gtcgacgggt tactcgccat cttcatcggg atactcgcca
     5281 acatccccgg tctactcgcc cacggtgcaa ttccagtcga gtccgtcgtt tgcgggcagc
     5341 ggtagcaaca tttactcgcc gggcaatgcg tactcgccca gctcgtccaa ctactccccc
     5401 aattcaccat cctactcgcc gacatcacca tcgtactcgc cgtcaagtcc ttcgtactcg
     5461 ccaacgtcgc cttgctattc gcccacatcg ccttcgtact cgccaacgag tccgaactac
     5521 acacccgtaa caccctcata ctcgccgaca agtccgaact attcagcgtc gccgcaatat
     5581 tctccagcct cgccagctta ctcgcaaacg ggggtgaagt actcaccgac atcgccgacg
     5641 tactcgccgc cgtcaccatc gtacgatggg tctcccggat caccacaata tacgccagga
     5701 tctccgcagt actcgccggc ctcgcctaag tactcgccga cctcaccgct gtactcgccc
     5761 agctcgccgc agcactcgcc ctcaaaccag tacagcccaa caggatcgac ctattcggcg
     5821 acgagtccgc ggtactcgcc gaacatgtcc atctactcgc cgagcagcac caagtactcg
     5881 cccacctcgc caacgtacac accgacggcc cgcaactact cgcccacgtc accgatgtac
     5941 tcgccaacgg ctccatcgca ctacagtccc acgagtccgg cctactcgcc cagcagtccc
     6001 acgttcgagg agagcgaaga ctgaggaagg gaggacgggg gtagctcccc cagcacgtcc
     6061 cgatctccgg ggcggtcaag ccgtagttaa gtaccgacta cgctcgatcg cccgaacggg
     6121 aaaggtgaat ttaataatat tatgtttgta tacagcaaat aggtctctca tacaaaattc
     6181 aatactgttt gcaaaagtag ctttaaacaa gttgtataaa ttagcctaca gtttcgtatt
     6241 tggttttgtg gtaaagtaaa cattttgaat tgtttgcgtt aaccagaaaa gcgaattcga
     6301 agccatttat atttgcacaa attgtttcaa gttgcaattc tcgaactgta ttcgataatg
     6361 cgaatctatt tctttgcaca acccactgta tgaaattgtt tactaactgg aagactcttg
     6421 tcactcttct gcaaagtact ttcacatttt tttgaatatc cctattctta ttttgcctaa
     6481 tgttagtata aagaccctag ttattaaaaa caacaacaaa acaagccaac gtcagacact
     6541 atttgtagcg ttttccatat accctttaaa tccctaatta acccgatcag ttgttttcgc
     6601 ctgcacacaa atgttactta taaagcataa gaatgcaggc acccacccat acactacact
     6661 atatattcat atatattttt acgtccgaca catttttgta aattatgaca gaaaacaaaa
     6721 tagaaaatta taaaat