Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_078535 5247 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_078535 VERSION NM_078535.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 5247) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 5247) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 5247) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 5247) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 5247) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 5247) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 5247) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 5247) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 5247) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 5247) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 5247) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 5247) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 5247) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 5247) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 5247) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 5247) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 5247) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 5247) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Dec 17, 2009 this sequence version replaced NM_078535.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5247 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..5247 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Neuroglian" /map="7F2-7F4" /db_xref="FLYBASE:FBgn0264975" /db_xref="GeneID:31792" CDS 456..4175 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="CG1634 gene product from transcript CG1634-RA; CG1634-PA; Nrg-PA; icebox; central brain deranged; neuroglian; lethal (1) G0488; female sterile(1)M72" /codon_start=1 /product="neuroglian, isoform A" /protein_id="NP_511090.1" /db_xref="FLYBASE:FBpp0071154" /db_xref="GeneID:31792" /db_xref="FLYBASE:FBgn0264975" /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL" misc_feature 540..839 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 618..632 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 657..671 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 735..749 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 777..794 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 819..830 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 864..1103 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 906..920 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 948..962 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1029..1043 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1080..1097 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1206..1451 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 1245..1259 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1284..1298 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1368..1382 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1395..1412 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1437..1448 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1470..1736 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 1470..1481 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 1497..1508 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 1521..1544 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1560..1577 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1584..1592 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 1614..1628 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 1632..1646 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1671..1697 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1704..1736 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 1791..2006 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1800..1814 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1839..1853 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1902..1916 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1944..1961 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1983..1994 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2016..2300 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2067..2081 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2112..2126 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2184..2198 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2226..2243 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2265..2276 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2292..2576 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature 2502..>3608 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2541..2546,2550..2555) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3204..3206,3414..3416,3459..3461) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3207..3476 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3576..3788 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(3765..3770,3774..3779) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3918..4166 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" ORIGIN 1 ccaaatcgta tttactgaaa actacgccga aaacaccgcg atacatattc gcagccgagc 61 gaatatatat cgttatttgg gtgtttaagc actaacttta tttatttttt cctaaaaatt 121 ccgcgtgtat aacataactg tcccagtgtg tgtgtatatg cgtcggtgtt agtgttagtg 181 agcgccggga attgaaaata aaatatgcaa cagcagaaag taataaaagc tcggctcgca 241 tgcaattttc attagtggga aaattgtttg atatttaaga ggcaaccgag gaataaacgg 301 aatcaacagc agcagacaca cacacacaca ttccaagcca aattaataat agaaaagaaa 361 aacaaaaaaa aaaaaacagc aaccagaaaa ccaataaaag tttaaaccaa aacgaaacac 421 actcgagggg gcgagcggag agccaaacga ccaaaatgtg gcggcagtca acgatactgg 481 ccgcgttact agtggctctt ttgtgtgcgg gcagtgcaga aagcaaaggc aatcgcccac 541 caagaatcac caaacaaccg gcacccggag aattgctctt caaagtggcg caacagaata 601 aggaaagtga caatccattc ataatcgagt gcgaagccga tggacaaccc gagccagaat 661 atagttggat caagaacggc aagaagttcg attggcaggc gtacgataac cgcatgctgc 721 ggcagccagg acgtggcacc ctggtgatca ccatacccaa ggacgaggat cgcggccact 781 atcagtgctt tgcgtccaat gaattcggaa cggccacctc gaactcagta tatgtgcgta 841 aggccgagct gaatgccttc aaggatgagg cggccaagac actggaggcc gtcgagggtg 901 agccctttat gctgaaatgt gccgcacccg atggttttcc cagtccgaca gtcaactgga 961 tgatccagga gtccatcgat ggcagcatca agtcgatcaa caactctcgc atgaccctcg 1021 atcctgaggg taatctctgg ttctcgaatg ttacccgtga ggatgccagc tccgatttct 1081 actatgcctg ctcggccacc tcggtgtttc gcagtgaata caagattggc aacaaggtgc 1141 tcctcgatgt caaacagatg ggcgttagtg cctcgcagaa caagcatccg cccgtgcgtc 1201 aatatgtttc ccgtcgccag tccttggcgt tgcgtggcaa gcgaatggaa ctgttttgca 1261 tctacggtgg aacaccgctg ccgcagaccg tgtggagcaa ggatggccag cgtatacagt 1321 ggagcgatcg aataacgcaa ggacactatg gcaaatcact ggtcattcgg cagacaaatt 1381 tcgatgatgc cggcacatac acctgcgacg tgtccaacgg tgtgggcaat gcccaatcct 1441 tctccatcat tctgaatgtt aactccgtgc cgtactttac caaagaacct gaaatcgcca 1501 ccgccgccga agacgaagag gttgtcttcg agtgtcgcgc tgctggtgta ccagagccca 1561 agatcagttg gattcacaat ggtaagccca tcgagcagag caccccgaat ccccgacgaa 1621 cggttacgga caacacaatt cgcattatca atctggttaa gggcgatact ggtaactacg 1681 gttgcaacgc caccaattcg ctgggatatg tgtataagga tgtctatcta aatgtccagg 1741 ctgagccgcc aacgatttcc gaagctccag cagctgtatc cactgtcgat ggaaggaatg 1801 tgaccattaa gtgcagggtt aacggttccc ccaagcctct ggttaaatgg ctaagggcca 1861 gcaactggct gaccggaggt cgttacaatg tccaagctaa cggtgacctg gagatccaag 1921 atgtgacatt ctcggatgcc ggcaaataca catgctatgc gcagaacaag tttggtgaaa 1981 ttcaagccga tggttcgctg gtggtcaagg agcatacgag aattacccaa gagccgcaaa 2041 actacgaggt ggccgccgga caatcggcca cgttccgctg taacgaggcc cacgacgata 2101 cgctggagat tgagatcgat tggtggaagg atggccagtc cattgacttt gaggcccagc 2161 cgcgattcgt gaagaccaat gataattccc tgacgattgc caagacaatg gagttggatt 2221 ctggcgaata tacgtgcgtg gcccggacgc gtttggatga ggcaacggcc agggcgaatt 2281 tgattgtcca ggatgtgccg aatgcaccaa aactgaccgg catcacctgc caggccgaca 2341 aggccgagat ccactgggaa cagcagggtg acaatcgttc gcccattctg cactacacca 2401 ttcagttcaa tacatcgttc acgcccgcct cctgggatgc cgcctacgag aaggtgccca 2461 acacggactc ctcgttcgtc gtccagatgt caccgtgggc caactatacg ttccgtgtga 2521 ttgccttcaa caagatcgga gcctcgccgc cgtcggcgca cagcgatagc tgcaccaccc 2581 agccggatgt gcccttcaag aatcccgaca atgtcgttgg ccagggcact gagcccaaca 2641 atctggtcat ctcgtggact cccatgcccg aaatcgagca caatgccccc aatttccatt 2701 attatgttag ctggaaacgc gatattcctg ccgctgcgtg ggaaaacaat aacatattcg 2761 actggcgaca gaacaacatt gtgattgccg atcaaccgac tttcgtgaaa tacctgatca 2821 aggtggtggc catcaacgat aggggtgagt ccaatgtggc cgccgaggag gtggttggct 2881 actctggcga agatcgtccc ctggatgcgc ccaccaactt cacaatgagg caaatcacat 2941 catcgaccag tggctacatg gcctggacgc cggtaagtga ggaatcggtg cgcggacact 3001 tcaagggcta caaaatccaa acgtggacgg agaacgaggg cgaggagggt ctgcgggaga 3061 tccatgtgaa gggtgatacc cacaacgctc tggtcacaca attcaagccc gattcaaaga 3121 actatgcccg cattttggct tacaatggac gcttcaatgg cccacccagt gccgtcatcg 3181 acttcgatac tccggagggt gtaccatcgc cggttcaggg actggatgcc tatcctctgg 3241 gctcctcggc cttcatgctc cactggaaga agccgctgta tcccaatggc aagctcactg 3301 gctacaagat ctactacgag gaggttaagg agagctatgt gggcgagcga cgcgaatacg 3361 atccacacat caccgatccc agggtcacac gcatgaagat ggccggcctg aagcccaact 3421 ccaagtaccg catctccatc actgccacca cgaaaatggg cgagggatct gaacactata 3481 tcgaaaagac cacgctcaag gatgccgtca atgtggcccc tgccacgcca tctttctcct 3541 gggagcaact gccatccgac aatggactag ccaagttccg catcaactgg ctgccaagta 3601 ccgagggtca tccaggcact cacttcttta cgatgcacag gatcaagggc gaaacccaat 3661 ggatacgcga gaatgaggaa aagaactccg attaccagga ggtcggtggc ttagatccgg 3721 agaccgccta cgagttccgc gtggtgtccg tggatggcca ctttaacacg gagagtgcca 3781 cgcaggagat cgacacgaac accgttgagg gaccaataat ggtggccaac gagacggtgg 3841 ccaatgccgg atggttcatt ggcatgatgc tggccctggc cttcatcatc atcctcttca 3901 tcatcatctg cattatccga cgcaatcggg gcggaaagta cgatgtccac gatcgggagc 3961 tggccaacgg ccggcgggat tatcccgaag agggcggatt ccacgagtac tcgcaaccgt 4021 tggataacaa gagcgctggt cgccaatccg tgagttcagc gaacaaaccg ggcgtggaaa 4081 gcgatactga ttcgatggcc gaatacggtg atggcgatac aggcatgaat gaagatggat 4141 cctttattgg ccaatatgga cgcaaaggac tttgatttaa ttagtaagca gcgcaccgca 4201 acagcaactc aaaaataata tcgaaaccga gcccttaacc ccaaaaatca aaaaatcaac 4261 aagaccaaac accatcacag cagaaaaatg aaaaaattaa tgaaaataat agtagcctac 4321 attttattcg actataagtg caaacaccac gactaattta aagtatatat aaaaatagag 4381 gttttatata taactattaa aatcttaaaa tgtgtaaaaa aaaaaacaaa caaacaaaat 4441 gaatgcaaat caatactgcc aaacaacttg aacaacaagc aacacaacag caaaaacaac 4501 aacaacgaga atgcagcaaa aaggctatta tcaaaataaa agtcttcata tcggaagaag 4561 tagttatcga aaaagaaatg catgcgaatc aaaccgaatt atgaaaaaaa aaatcatata 4621 attttctgga cgttatgggg atgatgcgtg taattttttt ttattttaaa gaaatttaag 4681 aaactatgta tgaggaaaat aatgaagctc gcttatgaaa tctctatatt gcgcacatgt 4741 ctacctgtcc cactctgtcc ccggtactct gtatatcttt gtcccgctct ctcccttctc 4801 tacttgtaat gcatatatat ttataaatat aaagcgtaaa taagttataa tttagtaatt 4861 tttttataaa gcaacagcac ttgaatgtca aatctccgtt ttagattggt cgtaaatcga 4921 aatgaaactc tcttttagct tacatgttta ctactttatt taagcctatt gtgtgtattt 4981 tgtttttatt tcattatttt atttttttta gttcgtgtaa tgactttgaa tttttttgct 5041 ttgaaattga aacaatgttt tagtatagcc tcgtgtttgt tttccgggaa gagcaacaaa 5101 aatgaagtgt attttttcag tgtatttaat attaaagaat gaatgacgaa aacatcataa 5161 ttatatgaaa atataatttt ttttacatat gttgatgtac gttcgcatat aaatttagaa 5221 agaaaacaaa taaaataaag aaaaccg