Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_057317 3127 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_057317 VERSION NM_057317.4 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 3127) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 3127) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 3127) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 3127) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 3127) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 3127) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 3127) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 3127) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 3127) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 3127) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 3127) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 3127) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 3127) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 3127) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 3127) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 3127) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 3127) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 3127) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jan 16, 2013 this sequence version replaced NM_057317.3. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3127 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..3127 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo" /map="2B14-2B14" /db_xref="FLYBASE:FBgn0000117" /db_xref="GeneID:31151" CDS 167..2698 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="CG11579 gene product from transcript CG11579-RD; CG11579-PD; arm-PD; amardillo; betaCatenin; Beta-catenin/Arm; Armadillo/beta-catenin; beta-Catenin; alpha-Catenin; beta-catenin/Armadillo; Armadillo/bgr;-catenin; armadillo; b-catenin; Armadillo(Arm)/beta-catenin" /codon_start=1 /product="armadillo, isoform D" /protein_id="NP_476665.2" /db_xref="FLYBASE:FBpp0089035" /db_xref="GeneID:31151" /db_xref="FLYBASE:FBgn0000117" /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGAVGGASGGGGNIGAIPPSG APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC" misc_feature 419..643 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="alpha-catenin binding domain found in Drosophila melanogaster armadillo segment polarity protein (dArm) and similar proteins; Region: CTNNAbd_dArm; cd21726" /db_xref="CDD:439243" misc_feature order(437..448,458..463,467..475,482..487,494..496, 548..556,560..565,572..577,584..586,593..619) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative CNTTA binding site [polypeptide binding]; other site" /db_xref="CDD:439243" misc_feature <614..>1108 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Adaptin N terminal region; Region: Adaptin_N; pfam01602" /db_xref="CDD:396262" misc_feature 647..724 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 743..859 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 878..976 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(947..949,959..961,971..973,1073..1075,1085..1087, 1097..1099,1202..1204,1214..1216,1226..1228) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 998..1108 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1124..1231 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1247..1360 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 1250..1357 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1394..1471 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(1442..1444,1454..1456,1466..1468,1574..1576, 1586..1588,1598..1600,1712..1714,1724..1726,1736..1738) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 1481..1609 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 1493..1609 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 1634..1741 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature order(1916..1918,1928..1930,1940..1942,2039..2041, 2051..2053,2063..2065,2162..2164,2174..2176,2186..2188) /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:293788" misc_feature 1955..2074 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="Armadillo/beta-catenin-like repeat; Region: Arm; pfam00514" /db_xref="CDD:425727" misc_feature 1964..2074 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" misc_feature 2087..2191 /gene="arm" /locus_tag="Dmel_CG11579" /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat; beta-cat-arm; beta-catenin; beta-Catenin; betacat; betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1; Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192; l(1)G0234; l(1)G0410; t12687 ALR Dm" /note="armadillo repeat [structural motif]; Region: armadillo repeat" /db_xref="CDD:293788" ORIGIN 1 tagaggagtt atcggttatc tgttctgcgc tcatatacac agttttcata gtcggggatt 61 tttgtcgaat ttaaatatct aagtgcgtca aaagtgcgtt aacctgcctt tgagcagata 121 aatttacttt cgaagcggtg tggtgtaaag cgcctcaatc accaagatga gttacatgcc 181 agcccagaat cgaaccatgt cgcataataa tcaatacaat ccacctgatc tgccgccgat 241 ggtatccgcc aaggagcaga ccctcatgtg gcagcagaat tcgtacttgg gcgactccgg 301 catccactcg ggtgccgtga cccaggttcc atcgctgtct ggcaaggagg acgaggagat 361 ggagggagat ccacttatgt tcgacctgga caccggtttc ccgcagaatt tcacacaaga 421 ccaagtggac gatatgaacc agcaactgag ccagacacgc tcccaacgtg tacgtgctgc 481 catgtttccg gaaaccctgg aggagggcat tgagattccc tccacccagt ttgatcccca 541 acagccgacg gcagtgcaac gtctttcgga accgtcacaa atgctaaagc acgcggtggt 601 caatctgatc aactaccagg acgacgctga gctggcaacc agggccatac ccgagttgat 661 caagctgctg aacgatgagg atcaggtggt agtttcccag gccgccatga tggtccacca 721 gctgtctaag aaggaggcct cgcgacatgc cattatgaac agccctcaga tggtagccgc 781 tttggtgcgt gccatctcta acagcaacga tctggagagc accaaggcag cggtaggaac 841 actgcacaac ttatcacacc atcgccaggg tctgctggcc atcttcaaga gtggcggcat 901 cccggcactc gtcaagttgc tctcctcgcc agtggagagt gtgctgttct atgcaattac 961 cactctgcac aatttgctgc tccaccagga tggctctaag atggctgtgc gcctggccgg 1021 cgggcttcag aagatggtta ctctgctgca acgaaacaac gttaagtttc tggctatcgt 1081 cacagattgc ttgcaaattc tggcctatgg taaccaggag agcaagttaa taattcttgc 1141 ctccggaggg cccaacgaac tcgtgcgcat tatgcgctcc tacgactacg agaagcttct 1201 gtggaccact tcgcgggtac tgaaagtgct ctccgtttgc tccagcaaca agccggccat 1261 cgtggatgcc ggtggaatgc aggcgctggc tatgcacttg ggtaacatgt caccgcgcct 1321 tgtgcaaaac tgtttgtgga cgctccgcaa tctttcggat gcagccacta aggtggaggg 1381 ccttgaagct ttgctccaat ctctcgtcca ggttctgggc tcgaccgatg tcaacgtggt 1441 cacctgtgcc gccggtatcc tttcaaatct gacgtgcaac aatcagcgca acaaggccac 1501 cgtttgtcag gtgggcggtg tggacgccct cgtccgtact attatcaatg ctggagatcg 1561 cgaagagatt accgagccgg ctgtatgtgc cctgcgtcac ttgacctcgc gtcatgtgga 1621 ctctgagttg gcccagaatg ccgtacgctt aaactacgga ctatcggtga ttgtaaagct 1681 attgcatcca ccatcacgct ggcccttgat caaggccgtc attggactca tacgcaattt 1741 ggccctctgt ccggccaatc acgccccgtt gcgggagcac ggggccatcc accatctggt 1801 gcgactgctt atgcgcgcct tccaagacac agagaggcaa cgttcctcga tagccaccac 1861 tggttcacag cagccgtccg catacgctga cggcgttcgc atggaggaga ttgtcgaggg 1921 cacggtgggg gcgctacata tcctggcccg cgagtctcac aaccgggcac tcattcgcca 1981 gcagtcggta ataccgatct ttgtacgatt gctgttcaac gaaatcgaga acatacagcg 2041 cgtggctgct ggcgttcttt gtgagctcgc cgctgacaag gagggcgccg agattatcga 2101 gcaggagggc gccactgggc cgctgaccga tctcctgcac tcgcgcaatg aaggcgtggc 2161 cacatacgcc gccgctgttc tctttcgcat gagtgaggac aagccgcagg attacaagaa 2221 gcggctatcc atagagctga ccaactcgct gctgcgcgag gacaacaaca tatgggccaa 2281 tgccgacctg ggcatgggtc ccgatctaca ggatatgctt ggaccagaag aagcatatga 2341 gggcctgtac ggacaaggtc cgcccagcgt gcacagttca cacggaggtc gcgcattcca 2401 tcagcaagga tatgatactc taccaataga ttcgatgcag ggtctggaga tcagcagccc 2461 agtgggcggc ggcggtgctg gcggtgctcc cggcaatggt ggagctgtag gcggagctag 2521 cggcggcggt ggtaacatcg gcgccattcc gcctagcggc gcaccaactt cgccctattc 2581 catggacatg gacgttggcg agattgatgc cggtgcattg aactttgact tggacgccat 2641 gccgacgcca cccaatgaca acaacaacct ggctgcctgg tacgataccg attgttagac 2701 aagccgagct aagggtaagg gtcgagtatc cattcgaccc cataacataa aacacacgaa 2761 ttcccatccc tgcacaatag ccctcttcca ccggctttga ttccatcccg gatcccggaa 2821 tcgcgatcac cgaaacttga ctagatcaac gaaggtgtgg attttacttg acaaatacga 2881 ggagctgcgg caggtcaaag ttctgcttcc agaactgaag tccgtgggag aaggctattt 2941 gctcacacac cataccccgc gacaaagcat acacacacgc atacatgcat aatattatac 3001 atttattata atgcgaacga aacggcaaga aaaacatatt atatgatgca ttacatatta 3061 cccacgtaaa cgaaatggaa aattaaacaa atgtttgcaa tagaactcgt acatttccct 3121 tcatatg