Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster armadillo (arm), transcript variant D,


LOCUS       NM_057317               3127 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_057317
VERSION     NM_057317.4
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 3127)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3127)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3127)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 3127)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 3127)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 3127)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 3127)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 3127)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 3127)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 3127)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 3127)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 3127)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 3127)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 3127)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 3127)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 3127)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 3127)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 3127)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 16, 2013 this sequence version replaced NM_057317.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3127
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..3127
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo"
                     /map="2B14-2B14"
                     /db_xref="FLYBASE:FBgn0000117"
                     /db_xref="GeneID:31151"
     CDS             167..2698
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="CG11579 gene product from transcript CG11579-RD;
                     CG11579-PD; arm-PD; amardillo; betaCatenin;
                     Beta-catenin/Arm; Armadillo/beta-catenin; beta-Catenin;
                     alpha-Catenin; beta-catenin/Armadillo;
                     Armadillo/bgr;-catenin; armadillo; b-catenin;
                     Armadillo(Arm)/beta-catenin"
                     /codon_start=1
                     /product="armadillo, isoform D"
                     /protein_id="NP_476665.2"
                     /db_xref="FLYBASE:FBpp0089035"
                     /db_xref="GeneID:31151"
                     /db_xref="FLYBASE:FBgn0000117"
                     /translation="MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDS
                     GIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRV
                     RAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA
                     IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLES
                     TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDG
                     SKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVR
                     IMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWT
                     LRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG
                     GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHP
                     PSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTG
                     SQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQ
                     RVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQD
                     YKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPEEAYEGLYGQGPPSVHSSHG
                     GRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGAVGGASGGGGNIGAIPPSG
                     APTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYDTDC"
     misc_feature    419..643
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="alpha-catenin binding domain found in Drosophila
                     melanogaster armadillo segment polarity protein (dArm) and
                     similar proteins; Region: CTNNAbd_dArm; cd21726"
                     /db_xref="CDD:439243"
     misc_feature    order(437..448,458..463,467..475,482..487,494..496,
                     548..556,560..565,572..577,584..586,593..619)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative CNTTA binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:439243"
     misc_feature    <614..>1108
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Adaptin N terminal region; Region: Adaptin_N;
                     pfam01602"
                     /db_xref="CDD:396262"
     misc_feature    647..724
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    743..859
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    878..976
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(947..949,959..961,971..973,1073..1075,1085..1087,
                     1097..1099,1202..1204,1214..1216,1226..1228)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    998..1108
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1124..1231
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1247..1360
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1250..1357
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1394..1471
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1442..1444,1454..1456,1466..1468,1574..1576,
                     1586..1588,1598..1600,1712..1714,1724..1726,1736..1738)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1481..1609
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1493..1609
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1634..1741
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1916..1918,1928..1930,1940..1942,2039..2041,
                     2051..2053,2063..2065,2162..2164,2174..2176,2186..2188)
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1955..2074
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="Armadillo/beta-catenin-like repeat; Region: Arm;
                     pfam00514"
                     /db_xref="CDD:425727"
     misc_feature    1964..2074
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    2087..2191
                     /gene="arm"
                     /locus_tag="Dmel_CG11579"
                     /gene_synonym="Arm; ARM; Armadillo; beta-cat; beta-Cat;
                     beta-cat-arm; beta-catenin; beta-Catenin; betacat;
                     betaCatenin; bgr;-Cat; CG11579; Dm Arm; dmCTNNB1;
                     Dmel\CG11579; EG:86E4.6; l(1)2Bv; l(1)arm; l(1)G0192;
                     l(1)G0234; l(1)G0410; t12687 ALR Dm"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
ORIGIN      
        1 tagaggagtt atcggttatc tgttctgcgc tcatatacac agttttcata gtcggggatt
       61 tttgtcgaat ttaaatatct aagtgcgtca aaagtgcgtt aacctgcctt tgagcagata
      121 aatttacttt cgaagcggtg tggtgtaaag cgcctcaatc accaagatga gttacatgcc
      181 agcccagaat cgaaccatgt cgcataataa tcaatacaat ccacctgatc tgccgccgat
      241 ggtatccgcc aaggagcaga ccctcatgtg gcagcagaat tcgtacttgg gcgactccgg
      301 catccactcg ggtgccgtga cccaggttcc atcgctgtct ggcaaggagg acgaggagat
      361 ggagggagat ccacttatgt tcgacctgga caccggtttc ccgcagaatt tcacacaaga
      421 ccaagtggac gatatgaacc agcaactgag ccagacacgc tcccaacgtg tacgtgctgc
      481 catgtttccg gaaaccctgg aggagggcat tgagattccc tccacccagt ttgatcccca
      541 acagccgacg gcagtgcaac gtctttcgga accgtcacaa atgctaaagc acgcggtggt
      601 caatctgatc aactaccagg acgacgctga gctggcaacc agggccatac ccgagttgat
      661 caagctgctg aacgatgagg atcaggtggt agtttcccag gccgccatga tggtccacca
      721 gctgtctaag aaggaggcct cgcgacatgc cattatgaac agccctcaga tggtagccgc
      781 tttggtgcgt gccatctcta acagcaacga tctggagagc accaaggcag cggtaggaac
      841 actgcacaac ttatcacacc atcgccaggg tctgctggcc atcttcaaga gtggcggcat
      901 cccggcactc gtcaagttgc tctcctcgcc agtggagagt gtgctgttct atgcaattac
      961 cactctgcac aatttgctgc tccaccagga tggctctaag atggctgtgc gcctggccgg
     1021 cgggcttcag aagatggtta ctctgctgca acgaaacaac gttaagtttc tggctatcgt
     1081 cacagattgc ttgcaaattc tggcctatgg taaccaggag agcaagttaa taattcttgc
     1141 ctccggaggg cccaacgaac tcgtgcgcat tatgcgctcc tacgactacg agaagcttct
     1201 gtggaccact tcgcgggtac tgaaagtgct ctccgtttgc tccagcaaca agccggccat
     1261 cgtggatgcc ggtggaatgc aggcgctggc tatgcacttg ggtaacatgt caccgcgcct
     1321 tgtgcaaaac tgtttgtgga cgctccgcaa tctttcggat gcagccacta aggtggaggg
     1381 ccttgaagct ttgctccaat ctctcgtcca ggttctgggc tcgaccgatg tcaacgtggt
     1441 cacctgtgcc gccggtatcc tttcaaatct gacgtgcaac aatcagcgca acaaggccac
     1501 cgtttgtcag gtgggcggtg tggacgccct cgtccgtact attatcaatg ctggagatcg
     1561 cgaagagatt accgagccgg ctgtatgtgc cctgcgtcac ttgacctcgc gtcatgtgga
     1621 ctctgagttg gcccagaatg ccgtacgctt aaactacgga ctatcggtga ttgtaaagct
     1681 attgcatcca ccatcacgct ggcccttgat caaggccgtc attggactca tacgcaattt
     1741 ggccctctgt ccggccaatc acgccccgtt gcgggagcac ggggccatcc accatctggt
     1801 gcgactgctt atgcgcgcct tccaagacac agagaggcaa cgttcctcga tagccaccac
     1861 tggttcacag cagccgtccg catacgctga cggcgttcgc atggaggaga ttgtcgaggg
     1921 cacggtgggg gcgctacata tcctggcccg cgagtctcac aaccgggcac tcattcgcca
     1981 gcagtcggta ataccgatct ttgtacgatt gctgttcaac gaaatcgaga acatacagcg
     2041 cgtggctgct ggcgttcttt gtgagctcgc cgctgacaag gagggcgccg agattatcga
     2101 gcaggagggc gccactgggc cgctgaccga tctcctgcac tcgcgcaatg aaggcgtggc
     2161 cacatacgcc gccgctgttc tctttcgcat gagtgaggac aagccgcagg attacaagaa
     2221 gcggctatcc atagagctga ccaactcgct gctgcgcgag gacaacaaca tatgggccaa
     2281 tgccgacctg ggcatgggtc ccgatctaca ggatatgctt ggaccagaag aagcatatga
     2341 gggcctgtac ggacaaggtc cgcccagcgt gcacagttca cacggaggtc gcgcattcca
     2401 tcagcaagga tatgatactc taccaataga ttcgatgcag ggtctggaga tcagcagccc
     2461 agtgggcggc ggcggtgctg gcggtgctcc cggcaatggt ggagctgtag gcggagctag
     2521 cggcggcggt ggtaacatcg gcgccattcc gcctagcggc gcaccaactt cgccctattc
     2581 catggacatg gacgttggcg agattgatgc cggtgcattg aactttgact tggacgccat
     2641 gccgacgcca cccaatgaca acaacaacct ggctgcctgg tacgataccg attgttagac
     2701 aagccgagct aagggtaagg gtcgagtatc cattcgaccc cataacataa aacacacgaa
     2761 ttcccatccc tgcacaatag ccctcttcca ccggctttga ttccatcccg gatcccggaa
     2821 tcgcgatcac cgaaacttga ctagatcaac gaaggtgtgg attttacttg acaaatacga
     2881 ggagctgcgg caggtcaaag ttctgcttcc agaactgaag tccgtgggag aaggctattt
     2941 gctcacacac cataccccgc gacaaagcat acacacacgc atacatgcat aatattatac
     3001 atttattata atgcgaacga aacggcaaga aaaacatatt atatgatgca ttacatatta
     3061 cccacgtaaa cgaaatggaa aattaaacaa atgtttgcaa tagaactcgt acatttccct
     3121 tcatatg