Stomoxys calcitrans general odorant-binding protein 19d-like

LOCUS       NM_001311254             663 bp    mRNA    linear   INV 24-JAN-2024
            (LOC106087404), mRNA.
ACCESSION   NM_001311254
VERSION     NM_001311254.1
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Olafson PU, Lohmeyer KH and Dowd SE.
  TITLE     Analysis of expressed sequence tags from a significant livestock
            pest, the stable fly (Stomoxys calcitrans), identifies transcripts
            with a putative role in chemosensation and sex determination
  JOURNAL   Arch Insect Biochem Physiol 74 (3), 179-204 (2010)
   PUBMED   20572127
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ233076.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FJ233076.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
                     /map="4"
     gene            1..663
                     /gene="LOC106087404"
                     /note="general odorant-binding protein 19d-like"
                     /db_xref="GeneID:106087404"
     exon            1..88
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    8..10
                     /gene="LOC106087404"
                     /note="upstream in-frame stop codon"
     CDS             35..427
                     /gene="LOC106087404"
                     /note="putative odorant binding protein"
                     /codon_start=1
                     /product="general odorant-binding protein 19d-like
                     precursor"
                     /protein_id="NP_001298183.1"
                     /db_xref="GeneID:106087404"
                     /translation="MKFFSVFLLMLVAVCYVKAEELTKENVIAIAMACKEEHGASDAD
                     MEAFKAHEGALTKEGKCMAACVMEKFGVLVEGKLDKDRAIEVGTAIFQEDAEKATAVV
                     EACVDLEADEDHCEAAVQYAACMKEHAA"
     sig_peptide     35..91
                     /gene="LOC106087404"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    113..409
                     /gene="LOC106087404"
                     /note="pheromone binding protein/general-odorant binding
                     protein (PBP/GOBP) family proteins; Region: PBP_GOBP;
                     cd23992"
                     /db_xref="CDD:467938"
     misc_feature    order(113..115,221..223,233..235,251..253,386..388,
                     407..409)
                     /gene="LOC106087404"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     exon            89..161
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
     exon            162..250
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
     exon            251..375
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
     exon            376..602
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
     exon            603..631
                     /gene="LOC106087404"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 gaataagtga cgtgagtgtt cgttcgttaa aaaaatgaag tttttcagtg ttttcttgtt
       61 aatgcttgta gctgtgtgtt atgttaaggc tgaagagtta accaaagaaa atgtcatcgc
      121 catagcaatg gcttgtaaag aagaacatgg agcatcggat gctgacatgg aggcattcaa
      181 ggctcatgag ggagccctaa ccaaagaagg aaaatgtatg gcagcatgtg taatggaaaa
      241 gttcggagtg ctggttgaag gcaaattgga caaagataga gcaattgaag tgggtacagc
      301 cattttccaa gaggatgctg agaaggcgac tgctgttgtg gaggcttgtg ttgatttaga
      361 agctgatgag gatcattgtg aagctgctgt tcaatatgcc gcttgtatga aggaacatgc
      421 agcctaaact tacgatcagt tcagcattgt gaataaatag cggataaacg accaccggaa
      481 atatgaatgg attttaagca ttttttgttt taaacagtgg acaagtaacg tgtttagtta
      541 gatcgatcat gtcaacattt taagctaaaa taaatagtta attgtaagaa agcatataaa
      601 aatcattttt gccaactggt taaggcatat accaaaaaaa aaaaaaaaaa aaaaaaaaaa
      661 aaa