Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Stomoxys calcitrans 40S ribosomal protein S14 (LOC106094183), mRNA.


LOCUS       NM_001311233             725 bp    mRNA    linear   INV 24-JAN-2024
ACCESSION   NM_001311233 XM_013261382
VERSION     NM_001311233.1
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
REFERENCE   1  (bases 1 to 725)
  AUTHORS   Wang X, Ribeiro JM, Broce AB, Wilkerson MJ and Kanost MR.
  TITLE     An insight into the transcriptome and proteome of the salivary
            gland of the stable fly, Stomoxys calcitrans
  JOURNAL   Insect Biochem Mol Biol 39 (9), 607-614 (2009)
   PUBMED   19576987
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF119387.1.
            
            On Aug 4, 2015 this sequence version replaced XM_013261382.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF119387.1, DN952619.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01915433, SAMN01915459
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..725
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
                     /map="4"
     gene            1..725
                     /gene="LOC106094183"
                     /note="40S ribosomal protein S14"
                     /db_xref="GeneID:106094183"
     misc_feature    39..41
                     /gene="LOC106094183"
                     /note="upstream in-frame stop codon"
     CDS             48..503
                     /gene="LOC106094183"
                     /note="ribosomal protein S14"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="NP_001298162.1"
                     /db_xref="GeneID:106094183"
                     /translation="MAPRKAKAQKEEVQVSLGPQVRDGEFVFGVAHIYASFNDTFVHV
                     TDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGG
                     NKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
     misc_feature    48..467
                     /gene="LOC106094183"
                     /note="40S ribosomal protein S14; Provisional; Region:
                     PTZ00129"
                     /db_xref="CDD:185465"
ORIGIN      
        1 cggcacgagc gcaattggat tgtttttaat aaagttgtta agacacaatg gctcctagaa
       61 aggctaaagc tcaaaaagaa gaagtccaag tctccttggg cccccaagtg cgtgatggcg
      121 aatttgtttt cggtgttgcc cacatctatg ccagtttcaa tgacactttc gtgcatgtca
      181 ccgatttgtc tggccgtgaa accattgccc gtgtcactgg cggcatgaag gtaaaagctg
      241 atcgtgatga agcctctccc tacgctgcta tgttggctgc tcaagatgtt gccgaaaaat
      301 gcaaaacctt gggcatcact gctttgcaca tcaaattgcg tgccaccggt ggcaacaaga
      361 ccaaaacccc tggacctggt gcccaatctg ccctccgtgc tttggcccgt tcttccatga
      421 agattggccg cattgaagat gttactccca ttccttccga ttccacacgc agaaagggtg
      481 gtcgtcgtgg tcgccgtttg taaacaaaca ttcatcatct ccaccatgtc ttgtgtactg
      541 ttatttggac ggcttgcagc agcagcgttt gttacacttc acacgttcaa cgttattgta
      601 tggacgttaa ggagttgaca aatgaaaatt attaaatttt tttaataagt gatcgtgaat
      661 aaaaaaaaca aaaaacaaga atttcgtatc caaaatacag accaaaaaaa aaaaaaaaaa
      721 aaaac