Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster Leucine-rich repeat-containing G


LOCUS       NM_001298263            2870 bp    mRNA    linear   INV 26-DEC-2023
            protein-coupled receptor 4 (Lgr4), transcript variant C, mRNA.
ACCESSION   NM_001298263
VERSION     NM_001298263.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 2870)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2870)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2870)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 2870)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 2870)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 2870)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 2870)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 2870)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 2870)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 2870)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 2870)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 2870)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 2870)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 2870)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 2870)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 2870)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 2870)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 2870)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2870
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..2870
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="Leucine-rich repeat-containing G protein-coupled
                     receptor 4"
                     /map="11E1-11E3"
                     /db_xref="FLYBASE:FBgn0085440"
                     /db_xref="GeneID:5740505"
     CDS             237..2666
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="CG34411 gene product from transcript CG34411-RC;
                     CG34411-PC; Lgr4-PC"
                     /codon_start=1
                     /product="Leucine-rich repeat-containing G protein-coupled
                     receptor 4, isoform C"
                     /protein_id="NP_001285192.1"
                     /db_xref="FLYBASE:FBpp0309261"
                     /db_xref="GeneID:5740505"
                     /db_xref="FLYBASE:FBgn0085440"
                     /translation="MSIAIMPHLPITFTLAILLAIASNEGAQGVESATRTAIEAIRTG
                     IGTKPETEIADATEAEAPVREVISLLGIIDGAESDILVPDADDKCPGGYFHCNTTAQC
                     VPQRANCDGSVDCDDASDEVNCVNEVDAKYWDHLYRKQPFGRHDNLRIGECLWPNENF
                     SCPCRGDEILCRFQQLTDIPERLPQHDLATLDLTGNNFETIHETFFSELPDVDSLVLK
                     FCSIREIASHAFDRLADNPLRTLYMDDNKLPHLPEHFFPEGNQLSILILARNHLHHLK
                     RSDFLNLQKLQELDLRGNRIGNFEAEVFARLPNLEVLYLNENHLKRLDPDRFPRTLLN
                     LHTLSLAYNQIEDIAANTFPFPRLRYLFLAGNRLSHIRDETFCNLSNLQGLHLNENRI
                     EGFDLEAFACLKNLSSLLLTGNRFQTLDSRVLKNLTSLDYIYFSWFHLCSAAMNVRVC
                     DPHGDGISSKLHLLDNQILRGSVWVMASIAVVGNLLVLLGRYFYKSRSNVEHSLYLRH
                     LAASDFLMGIYLTLIACADISFRGEYIKYEETWRHSGVCAFAGFLSTFSCQSSTLLLT
                     LVTWDRLMSVTRPLKPRDTEKVRIVLRLLLLWGISFGLAAAPLLPNPYFGSHFYGNNG
                     VCLSLHIHDPYAKGWEYSALLFILVNTLSLIFILFSYIRMLQAIRDSGGGMRSTHSGR
                     ENVVATRFAIIVTTDCACWLPIIVVKLAALSGCEISPDLYAWLAVLVLPVNSALNPVL
                     YTLTTAAFKQQLRRYCHTLPSCSLVNNETRSQTQTAYESGLSVSLAHLGGGVGGGSGR
                     KRMSHRQMSYL"
     misc_feature    495..608
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(516..518,543..545,576..581)
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(555..557,564..566,576..578,594..599)
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    585..599
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    735..>1526
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    798..869
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    870..941
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    948..1019
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1020..1091
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1092..1163
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1164..1238
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1239..1307
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1308..1379
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1380..1451
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1452..1517
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1635..2492
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="relaxin family peptide receptors, member of the
                     class A family of seven-transmembrane G protein-coupled
                     receptors; Region: 7tmA_Relaxin_R; cd15137"
                     /db_xref="CDD:320265"
     misc_feature    1638..1718
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320265"
     misc_feature    1740..1817
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320265"
     misc_feature    order(1803..1805,1812..1817,1875..1892,1896..1901,
                     1908..1910,2040..2042,2046..2060,2148..2150,2157..2165,
                     2169..2177,2181..2186,2337..2339,2346..2351,2355..2360,
                     2367..2369,2391..2396,2400..2408,2415..2417,2424..2429)
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="putative peptide ligand binding pocket [polypeptide
                     binding]; other site"
                     /db_xref="CDD:320265"
     misc_feature    1875..1967
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320265"
     misc_feature    1998..2066
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320265"
     misc_feature    2148..2237
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320265"
     misc_feature    2277..2369
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320265"
     misc_feature    2394..2471
                     /gene="Lgr4"
                     /locus_tag="Dmel_CG34411"
                     /old_locus_tag="CG32637"
                     /old_locus_tag="CG4187"
                     /old_locus_tag="Dmel_CG32637"
                     /old_locus_tag="Dmel_CG4187"
                     /gene_synonym="anon-WO0170980.19; anon-WO0170980.20;
                     CG32637; CG34411; CG4187; dLGR4; DLGR4; Dmel\CG34411;
                     lgr4; LGR4"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320265"
ORIGIN      
        1 cgtctgctgc ggaccaaaaa tcgactatat tccgactata taccgcgcat atatattttt
       61 ggatccaccg atccgcgatc ttacacattg aagtgcggcg aagttttatt ttgattttga
      121 ttctttttgg tttttttttg tttttttttt gtgctgtgcc catcagagtc tataattaaa
      181 tattgtttat tgcccgttga gacggtggaa gaaaaaaaaa gcgaagaact ccctggatgt
      241 caatagcgat catgcctcac ctgcctatca catttactct cgccatcctg ctcgcaattg
      301 cttctaatga aggcgcgcaa ggcgtagaaa gtgcgacaag gacggcaatt gaagctatac
      361 gaacaggaat cggcacgaaa ccggaaacgg aaattgcgga cgccacagag gcggaagccc
      421 ccgtgcgaga ggtaatatcg ctgctgggca taatcgatgg tgctgagtcc gatatcctgg
      481 ttcccgacgc cgacgacaag tgtcctggcg gctatttcca ctgcaataca acggcacagt
      541 gtgttccaca gcgggccaac tgtgacggca gtgtcgactg cgatgacgca tcggatgagg
      601 tgaactgcgt gaacgaggtg gacgccaagt actgggatca cctgtacaga aagcagccat
      661 tcgggagaca cgataatctc aggattggcg aatgcctttg gcccaacgaa aacttttcct
      721 gtccctgtcg aggtgatgaa attctatgca gatttcagca gctaaccgat attccagaac
      781 gactgccgca gcacgatctg gcaacgctcg atctaacggg aaacaatttc gaaaccatcc
      841 acgaaacttt cttcagtgaa ctgccagacg tcgatagctt agtgctgaag ttctgctcaa
      901 tccgtgagat tgcctcgcat gcattcgatc gcctggcgga caacccactg aggacccttt
      961 atatggacga taataaatta ccgcatctgc cggaacactt cttccccgag ggcaatcaat
     1021 tgagtattct cattttggca cgcaaccacc tgcaccattt gaaacgaagc gattttctca
     1081 atctacagaa gttacaggaa ctggaccttc gcggcaatcg cataggaaac ttcgaagccg
     1141 aggtctttgc ccgactaccg aatttggagg tgctctatct caatgaaaac cacttaaagc
     1201 gtctggatcc agatagattt cccagaaccc tgctcaatct gcacactttg tccttggctt
     1261 acaatcagat cgaggacatc gccgcgaata cattcccctt tccacgcctt cgatacttat
     1321 ttctggctgg caatcgatta tcccacatac gagatgaaac attttgcaat ctcagcaatc
     1381 tacaaggatt acacttgaac gagaaccgga tcgaaggctt cgacctggag gccttcgctt
     1441 gtttgaagaa cctaagctct ctgctcctaa cgggcaatcg cttccagacc ctcgattcgc
     1501 gagttctaaa aaacctaacc agcctggatt atatttactt ctcgtggttc catttgtgta
     1561 gcgccgccat gaatgtccgg gtctgtgatc cacacggcga tggcatcagc agcaagttgc
     1621 acctgctgga caatcagata ttgcgaggca gtgtctgggt gatggcctcg attgccgtgg
     1681 ttggcaacct attggtcctg ctcggtcgct acttctacaa atcacggagc aacgtggagc
     1741 actcgctcta ccttcgccat ttggccgcca gtgatttcct catgggcatt tacctcacat
     1801 tgattgcctg tgcggatatc agttttcgcg gcgagtatat caaatacgag gagacctggc
     1861 ggcatagcgg cgtttgtgcc ttcgcaggct tcctcagcac cttcagctgc cagtcgtcga
     1921 cgctgctgct cacattggtc acctgggatc gtctgatgtc ggtgacgagg cccctcaagc
     1981 cacgggatac ggaaaaagtt cgcattgtcc tacgccttct gctgttgtgg ggcataagtt
     2041 tcggattagc tgcagctcca cttcttccca atccgtactt tggtagccat ttctacggca
     2101 acaatggtgt ctgcttatcg ctgcatatcc acgatcccta tgcgaagggt tgggagtact
     2161 cggcgctgct gttcatcctg gtcaatacgt tgtcactgat cttcatcctc ttttcctaca
     2221 ttcgaatgtt gcaagcgata agggattcgg gtggcggaat gcgaagcact cacagcggtc
     2281 gcgagaatgt ggtagcaact cgctttgcca tcattgtgac caccgattgc gcctgctggc
     2341 tgcccataat tgtggtcaaa ttggctgctc tttcaggctg cgaaatctcg cccgatcttt
     2401 acgcctggct ggcggttctt gtgctgccag tgaactcggc cctcaatcca gtgctctaca
     2461 cattgaccac tgcggccttt aagcaacagc tgcgtcgcta ctgtcacacc ctgcccagct
     2521 gctcgctggt gaacaacgag acccgatccc agacccagac tgcctacgag tccggactga
     2581 gtgtcagtct ggcgcacttg ggcggtggtg tgggcggcgg gtcggggcga aagcggatgt
     2641 cacaccggca gatgagctat ctgtaggcgg gcgcaactgg cttaaaatgc agcacgagat
     2701 caacagactg gggctagtgg gtgggtggca ttacaacagg acacttccat gtaattggtc
     2761 ccttagacta ttggtattat acgtacttat tgatacttat tctaatatca attttaaatt
     2821 acttataaca tttgaggata tgataacata aaccttagac aagagattcc