Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001298224 1449 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_001298224 VERSION NM_001298224.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1449) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1449) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1449) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1449) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1449) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1449) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1449) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1449) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1449) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1449) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1449) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1449) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1449) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1449) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1449) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1449) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1449) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1449) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1449 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1449 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /map="11A11-11A11" /db_xref="FLYBASE:FBgn0030391" /db_xref="GeneID:32195" CDS 112..879 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="CG1900 gene product from transcript CG1900-RC; CG1900-PC; Rab40-PC" /codon_start=1 /product="Rab40, isoform C" /protein_id="NP_001285153.1" /db_xref="FLYBASE:FBpp0308873" /db_xref="GeneID:32195" /db_xref="FLYBASE:FBgn0030391" /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN AYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDR WLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRE SFCELARMALHRNGMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLK SYALTTSQCFNSLTQSSKSKNRCKTPTSSSRNSCAIA" misc_feature 127..876 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c; Region: Rab40; cd04121" /db_xref="CDD:133321" misc_feature 145..150 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:133321" misc_feature 163..186 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G1 box; other site" /db_xref="CDD:133321" misc_feature order(169..189,217..219,232..234,310..312,472..477, 481..483,562..570) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133321" misc_feature 187..219 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:133321" misc_feature order(217..219,232..252) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Switch I region; other site" /db_xref="CDD:133321" misc_feature 232..234 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G2 box; other site" /db_xref="CDD:133321" misc_feature order(235..237,241..249,292..294,298..300,319..324, 331..333,343..345,358..360) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative effector interaction site [active]" /db_xref="CDD:133321" misc_feature order(235..240,244..246,298..303,322..324,328..330, 334..342) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:133321" misc_feature 235..249 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:133321" misc_feature order(238..261,280..282,286..288) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133321" misc_feature 286..300 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:133321" misc_feature 301..312 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G3 box; other site" /db_xref="CDD:133321" misc_feature order(310..312,316..348) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Switch II region; other site" /db_xref="CDD:133321" misc_feature 319..336 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:133321" misc_feature 343..357 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:133321" misc_feature 370..387 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:133321" misc_feature 439..465 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:133321" misc_feature 472..483 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G4 box; other site" /db_xref="CDD:133321" misc_feature 562..570 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="G5 box; other site" /db_xref="CDD:133321" misc_feature 610..630 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:133321" misc_feature 655..783 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins...; Region: SOCS; cl02533" /db_xref="CDD:470605" misc_feature order(658..675,691..693,712..714,730..732) /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="elongin B/C interaction [active]" /db_xref="CDD:239641" misc_feature 865..876 /gene="Rab40" /locus_tag="Dmel_CG1900" /gene_synonym="24641533; CG1900; Dmel\CG1900; DmRab40; Q8IR80; rab40" /note="putative lipid modification site [posttranslational modification]; other site" /db_xref="CDD:133321" ORIGIN 1 tgagtgtgta aggtaatttc cggcattcat atggaacact ctagaggaac tatgtattta 61 aaaatacttt gccctagaaa atgtgttgag ctgcttaaaa gtttgagcca catgggaacc 121 atgaccaagg actacgacta tctgctaaag gttctactgg tgggcgacag cgatgtgggc 181 aagcacgaga ttctctcaaa cctggaggat ccctccacgg agagtccctt ctgcagtggg 241 aacgcctaca agacgaccac catcctgctg gagggcaagc gggtgaagct gcagctgtgg 301 gacacctccg gccagggacg cttctgcacg atcattcgct cctattcgcg cggcgcccag 361 ggcatcatcc tcgtctacga catcaccaac aagtggagct tcgacggtat cgatcggtgg 421 ctcaaggagg tcgacgagca cgccccagga attccgaagg ttcttgtcgg gaatcgcctg 481 cacttggcct tcaagcgaca ggtggcggcc aaacaggccg agacctacgc cagccgcaac 541 aatatgtcct gcttcgagat atcgcctctc tgcaacttca acatccgcga gtccttttgc 601 gaactggcgc ggatggccct gcatcgcaac ggcatggagc acatctggcg cagcaataag 661 gtgctgtcgc ttcaggaatt gtgctgcagg acaattgtgc gaaggacgag cgtgtatgcg 721 atcgattcgc tgccgctgcc gccgtcggtg aagtcgacgc tcaagtcata cgcgctgacc 781 acgtcccagt gcttcaattc actgacccag agctccaaga gcaagaaccg ctgcaagacg 841 ccgacgagca gcagtcggaa tagctgtgcg atcgcgtgat cgttgccttg taggccgccg 901 cccagccgcc tacgccgcca cgcccctaac cgacattaac tttaattgag ctctacttat 961 gtactctagg ctataacaca cacacacaca cacacaccca taccataccc atacccatta 1021 ccatacacac attcaaccca gctctttggt tatatgtttt gttttattga cattgatatt 1081 tgtggtcaac aatgtttact ttttacacag taaagcatgc acctttttta gtttttaacc 1141 acccccatcc caggcccatt cccccaactt ctctattttg cattaatcta atgttgttaa 1201 tattattatg tttgtataat tctaatattt aatgcatcaa acacatcaac atataagaaa 1261 tgaaaaacaa aaacgaagaa ataacatcaa gtgaaaatca acttttatat ggataaaaag 1321 aattaaattt tttttttgtt tgtttaccat tcggattaaa atattcttag atatgtattg 1381 taattgaagc gaattcagca agagaagcac acacaaaggc gaattgataa aaataattca 1441 taatgaact