Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster megalin, transcript variant D (mgl), mRNA.


LOCUS       NM_001298125           15850 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_001298125
VERSION     NM_001298125.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 15850)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 15850)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 15850)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 15850)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 15850)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 15850)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 15850)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 15850)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 15850)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 15850)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 15850)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 15850)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 15850)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 15850)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 15850)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 15850)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 15850)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 15850)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..15850
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..15850
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Megalin"
                     /map="8D9-8E4"
                     /db_xref="FLYBASE:FBgn0261260"
                     /db_xref="GeneID:8674055"
     CDS             1077..15386
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="CG42611 gene product from transcript CG42611-RD;
                     CG42611-PD; mgl-PD; LDL receptor-related protein 2"
                     /codon_start=1
                     /product="megalin, isoform D"
                     /protein_id="NP_001285054.1"
                     /db_xref="FLYBASE:FBpp0310027"
                     /db_xref="GeneID:8674055"
                     /db_xref="FLYBASE:FBgn0261260"
                     /translation="MNPTPVGIGFGFGRKPPSKARMRSRWRPPSATTLLTHDPANGDS
                     HTAADPLQVTDAAPSGPPSSSSSSPIGDRHSQHHSSSAIDRRLQQQQHHQSPQHHRQR
                     GQLTTLALLLLALVAISNLETLLAVRTEGPRNRHGSPGGSLASTGGSSSGINTECPTD
                     SFRCNNGKCISHHWVCNYQKDCDDGEDEMQSCPPPECETPQLNCGQYTFNKTYCIPPH
                     YRCDMIEDCEDKSDEAQCTYRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYL
                     DCRTGRDEVGCSGVACRLDQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHH
                     AQFRCTNALCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILK
                     SQLCDGKRDCEDGSDEETNCSIASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTC
                     VDLDECAEWGHCDQLCTNTLGSYTCQCAQGYTLINDSKCIAPDANNLQLIFAHDRAIM
                     RMLPHGSEPKILANATAAAGVTFHYARNTLYWSDIKTRKVQSLPLDAQNKAVSPFDQT
                     LPGTWAPVALAVDWVGDKIYVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPT
                     AGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESV
                     DYEGAHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAK
                     DIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQL
                     ETDLKLCKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVVSRRARFVGLDFDARDE
                     FIYYSDVLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVL
                     STRNVTHRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANTDGSGLLVFKNVT
                     LGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMY
                     ITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQPCHRNNGGC
                     QKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGERLADDQVSCIPDPSAEPPVQ
                     PCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGRCIPQ
                     NFRCDQENDCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDF
                     CAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQ
                     CVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDC
                     SDHSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKC
                     PHGQWQCPGVSERCVNITSVCDDTPDCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPN
                     GALCVCPPGSEIGEDGYTCIDSNECDPPGLCSQQCTNTKGSYFCSCTDGYVLEPNKHT
                     CKAVNHTAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKL
                     KKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVL
                     VRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLT
                     LDIATKRVYFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQL
                     NRVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMTPNPCAGSRCQHLCLLSPSAP
                     EGYSCKCRPGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIES
                     STGLDFDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGIENGIVGAPYTIAFD
                     WLGRNLYIGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIALDPTEGKLFW
                     IDEGVLEVPIKIGRVDMNGQNPIVVFQEFAHPESLAVDTEKKMVYYSASNPAVIGVMD
                     YNGDDHTLILMKDSHPMAKPRSLGILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNE
                     SDLRSMMIYKKRALMQHPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEINCVAYK
                     IFAVVSQLDMIRGYSLSDSSEAMVPISGPGHHILHVDVMYREQWIYWAEYNRGYWNGI
                     FRSRPNGTDLQHVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRK
                     VLVKTTTDAPRELAVNPIKRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLT
                     IDMQTHDIYWVDSKLDTIQKISYNGANRKIIRRDLPNPMGIAVYLNDVYWVDRNLMTV
                     FKASKHSANETATSVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPP
                     DGGASGTSGGRNFRCECATGKLSADERKCEVVNEYLVFATRTEIRAVNLDPHSTEVPF
                     TPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGHDDITVVLNKGINPEGI
                     AYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLDPCNGTLFFTDWGRF
                     GTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIERSDLDGQN
                     RELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKRLEDSPRDIRI
                     YSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEA
                     SKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKC
                     DHENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDETHERC
                     PMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNH
                     RCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDC
                     LDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTT
                     LHNCATQQPCGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFT
                     CQNFKCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYP
                     DCADESDEPAHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDE
                     CLEQPGACSQHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNM
                     SVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAV
                     IRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVVDPRAIVVHPG
                     IGYLYFTSWHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLD
                     YIAYADLEGRHRHTVLSGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVL
                     RNTTHRPYDLHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAP
                     IFKCACPNQFYLARDMKTCVANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPA
                     TCAPRHCRAGTFQCKNTNCTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRC
                     ILDSWRCDGDADCKDGSDEDPAVCFKRTCDPKTEFSCKNGRCIPQLWMCDFDNDCGDD
                     SDEPAYMCRQRNCTTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCNPE
                     TDFKCGNNRCIPKQWMCDFADDCGDASDENEAVCKGRYRECSESEFRCGNGKCISSRW
                     QCDHEDDCGDNSDEMHCEGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPP
                     RFPGGRYCPESRFQCNNNLCVSLSDLCDGTDDCGDGSDEDPSVCSDFNCDTLRRFQCS
                     NERCVARYQICDGVDNCGDGSDENNMTLCASKQKPCDLYTQYQCANKHCIERSQVCDF
                     SDDCGDASDELGCHHTSSCSEANRGGCQQHCHNLTDGGYICTCYPGYIIAADNKKKCS
                     DVDECLTRQHTCSHQCHNLNGTYSCSCREGFHLTDGASGVCRAEKEDVILLFVNGQEI
                     RGLNWHKSEEFAVIAAEKRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIG
                     FAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRYRRSIVNAG
                     LEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEMIRHPAGLTIDYSQD
                     HIIYWVDTKLNAIESMRADGSRRKAIVRGDQLRHPVSLDLFESNMFWMTRDTGELVRQ
                     DKFGRGVQVVLHRYIVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLLVPGGHRCACP
                     DASGPPPSHRSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELLCECRTQFVGE
                     HCETSTMGAFGHGDANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARMPAMTSS
                     QSVTFRHGSNVEFNESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYDAVQS
                     GTTADPGMGNGSGIYDVPGEPSAKVKSMGHHAGGSFTEPASAIIAPSSITHKASPQLQ
                     LRTRELDPSADTGKDTQFLVEEDKSEC"
     misc_feature    1545..1643
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1560..1562,1584..1586,1617..1622)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1596..1598,1605..1607,1617..1619,1635..1640)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1626..1640
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1686..1784
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1701..1703,1719..1721,1752..1757)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1731..1733,1740..1742,1752..1754,1770..1775)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1761..1775
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1950..2057
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1965..1967,1992..1994,2025..2030)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2004..2006,2013..2015,2025..2027,2043..2048)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2034..2048
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2070..2174
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2085..2087,2109..2111,2142..2147)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2121..2123,2130..2132,2142..2144,2160..2165)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2151..2165
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2187..2312
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2202..2204,2244..2246,2277..2282)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2256..2258,2265..2267,2277..2279,2295..2300)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2286..2300
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <2415..2540
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:469594"
     misc_feature    <2550..2978
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="DNA-binding beta-propeller fold protein YncE
                     [General function prediction only]; Region: YncE; COG3391"
                     /db_xref="CDD:442618"
     misc_feature    2793..>3224
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    2793..2906
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2922..3038
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    3045..3155
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    3363..3491
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    3636..>4052
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Sugar lactone lactonase YvrE [Carbohydrate
                     transport and metabolism]; Region: YvrE; COG3386"
                     /db_xref="CDD:442613"
     misc_feature    3840..3968
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    3993..4097
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    4638..4745
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(4656..4658,4680..4682,4713..4718)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4692..4694,4701..4703,4713..4715,4731..4736)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4722..4736
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4755..4853
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4773..4775,4797..4799,4830..4835)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4809..4811,4818..4820,4830..4832,4848..4853)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4839..4853
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4878..4985
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4893..4895,4920..4922,4953..4958)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4932..4934,4941..4943,4953..4955,4971..4976)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4962..4976
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4998..5105
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(5013..5015,5040..5042,5073..5078)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5052..5054,5061..5063,5073..5075,5091..5096)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5082..5096
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5142..5237
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(5145..5147,5172..5174,5205..5210)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5184..5186,5193..5195,5205..5207,5223..5228)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5214..5228
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5247..5345
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(5265..5267,5289..5291,5322..5327)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5301..5303,5310..5312,5322..5324,5340..5345)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5331..5345
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5379..5483
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(5397..5399,5427..5429,5460..5465)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5439..5441,5448..5450,5460..5462,5478..5483)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5469..5483
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5640..5735
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    5949..6071
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6075..6209
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6144..6263
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    6210..6338
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7032..7187
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7527..>7613
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    7851..7991
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8052..8174
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    8130..8252
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8811..>9209
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    8853..8942
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8976..9110
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    9087..9215
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    9675..9779
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9690..9692,9714..9716,9747..9752)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9726..9728,9735..9737,9747..9749,9765..9770)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9756..9770
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9792..9899
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9807..9809,9831..9833,9864..9869)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9843..9845,9852..9854,9864..9866,9888..9893)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    order(9873..9878,9885..9893)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9924..10025
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9939..9941,9966..9968,9999..10004)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9978..9980,9987..9989,9999..10001,10017..10022)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10008..10022
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10176..10274
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10194..10196,10218..10220,10251..10256)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10230..10232,10239..10241,10251..10253,10269..10274)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10260..10274
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10314..10421
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10323..10325,10365..10367,10398..10403)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10377..10379,10386..10388,10398..10400,10416..10421)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10407..10421
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10458..10553
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10473..10475,10497..10499,10530..10535)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10509..10511,10518..10520,10530..10532,10548..10553)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10539..10553
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10584..10688
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10599..10601,10623..10625,10656..10661)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10635..10637,10644..10646,10656..10658,10674..10679)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10665..10679
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10704..10802
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10722..10724,10746..10748,10779..10784)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10758..10760,10767..10769,10779..10781,10797..10802)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10788..10802
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10851..10937
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10953..11063
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11160..11258
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11292..11420
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11478..11609
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    11568..11684
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11682..11810
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11895..12053
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    12063..12164
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12078..12080,12108..12110,12141..12146)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12120..12122,12129..12131,12141..12143,12159..12164)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12150..12164
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12189..12293
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12204..12206,12228..12230,12261..12266)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12240..12242,12249..12251,12261..12263,12279..12284)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12270..12284
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12303..12401
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12318..12320,12345..12347,12378..12383)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12357..12359,12366..12368,12378..12380,12396..12401)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12387..12401
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12426..12527
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12447..12449,12471..12473,12504..12509)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12483..12485,12492..12494,12504..12506,12522..12527)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12513..12527
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12555..12659
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12570..12572,12603..12605,12636..12641)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12615..12617,12624..12626,12636..12638,12654..12659)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12645..12659
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12687..12779
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12699..12701,12723..12725,12756..12761)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12735..12737,12744..12746,12756..12758,12774..12779)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12765..12779
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12813..12917
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12828..12830,12852..12854,12885..12890)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12864..12866,12873..12875,12885..12887,12903..12908)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12894..12908
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12930..13034
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12945..12947,12969..12971,13002..13007)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12981..12983,12990..12992,13002..13004,13020..13025)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13011..13025
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13062..13157
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(13077..13079,13101..13103,13134..13139)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13113..13115,13122..13124,13134..13136,13152..13157)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13143..13157
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13203..13289
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(13203..13205,13227..13229,13260..13265)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13239..13241,13248..13250,13260..13262,13278..13283)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13269..13283
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13332..13427
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(13338..13340,13362..13364,13395..13400)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13374..13376,13383..13385,13395..13397,13413..13418)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13404..13418
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13563..13658
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(13563..13565,13572..13574,13614..13616)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    13902..>14354
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    13947..14084
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    14124..14249
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    14196..14327
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    14202..14342
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
ORIGIN      
        1 ttggttctgt tttttttcca tattttctct attttacctg ttgcattggc ctgccaccaa
       61 caacaacaag aagaaagcaa caacaaaagg atatattaag aaaatttgta aagaaaagtg
      121 ccagcacaag gatttttgct ctctctctcg cacgatgctg ctctctcgct cacgctcgtt
      181 ctctcgctct ctgtctggat tacgctcttc tttttgccag tgacaggatt gcagtgcaaa
      241 aaacgaagga gctctgtgaa aaactccgag ggatatgcaa tttccttatc aaacgaaaga
      301 gccaacaaca acaagcgaca agatgccatc tccgtctctc tcacaccata ttaattttta
      361 tttttcaagt gtctgaagta caacaatcga caaaatacaa aaaaaaaaaa aaaaaagaag
      421 agaaaaaacc gacgaaaaat tgtataaaaa taaatacgaa aaagaaaatc gcggggaaaa
      481 ggagaaaagt ttaaagacgc cgaaggcaaa agttcacata aagcagccga aaaaagtttt
      541 tcaattattg taaaaagtgt taaaaagata gggccaaacg ccagcaagcg agctagagag
      601 agagagagag agagacgggg ctagagtgcg agcgaggcag cgagcaatta tctttcataa
      661 gcaaaaaagt ttagcaggca aaagagcaaa cggaataaga cgagcgggcc aaaacgaatg
      721 gggggagtta aatttaatta attgctctct caagtgccac ccccccggcc acgcccccta
      781 ataataaatt agaaatatta aacgcgttaa ttttccgctt atttcattaa agcagcccac
      841 caaaagaaaa aaataaatat tccaaaaagt aaaacgcaac aaagccagag gagcgggcaa
      901 ccctaaaaaa gacagaagtg cggtgggcag agaagaggtc accagagggt caccaaaaaa
      961 aacaaaaaaa aaccgaaacg aacaagaccc aaatccgaat cgaggattcc cacagaaacc
     1021 aaacaggaaa aggagaaagg agcggagcag caagcgaagc gcccgacgaa ccaaaaatga
     1081 atccgacgcc cgtgggcatt ggattcggat ttggtcgcaa gccgcccagc aaggccagaa
     1141 tgcgttctcg ctggcgacca ccatcagcga caaccctgct gacccatgac cccgccaacg
     1201 gcgacagcca tacggccgcc gatccgctgc aggtcactga tgccgcccca tcgggcccac
     1261 catcatcttc atcatcctcg cccatcggcg accgccattc acagcatcac agcagcagcg
     1321 ccatcgatcg gaggctgcag cagcagcagc accaccaatc accgcagcac catcgtcagc
     1381 gcggccagtt gacaaccctg gcgctgctgc tactggccct tgtggccatc agcaacctgg
     1441 aaaccctgct cgccgtgcgc accgaaggac cgcgcaaccg tcatggatca ccaggtggca
     1501 gcctggccag cacaggtggc agcagcagtg gcatcaacac ggagtgtcca acggactcgt
     1561 ttcgatgcaa caatggcaag tgcatctcgc accactgggt ctgcaattat caaaaggact
     1621 gcgacgatgg cgaggatgag atgcagtcgt gccctccacc ggaatgcgaa acgccgcagt
     1681 tgaattgcgg gcagtacacg ttcaacaaga cctactgcat ccctccgcac tatcgctgcg
     1741 atatgatcga ggattgtgag gacaaatcgg atgaggcgca gtgcacgtac cgcaagtgcc
     1801 agcacacgga cttgttttgc aacacgccca ctggagcacc ggcggagggc gcccgcctca
     1861 ccggaccctg tgtgcccaag gagaagcgct gcgacggcta cttggactgc cgcaccgggc
     1921 gggatgaggt cggctgcagt ggcgtagcct gtcgcctcga ccagttccgc tgtgccaacg
     1981 gactcaagtg catcgacgcc gccctgaagt gcaatcaccg cgatgattgt ggcgacaact
     2041 ctgacgagca gggatgcaac ttcccgccat gccaccacgc ccagttccgt tgcacgaacg
     2101 cactgtgcat accgtacaac tttcattgcg atggctacca cgactgcgcc gacaagagcg
     2161 acgaggccaa ctgcacggcc atcgcctgtc cggacaacaa gcacctctgt ccacgtggcg
     2221 gcgccagcgg cacgcccaag tgcatcctga agtcgcaact ctgcgacggc aagcgggact
     2281 gcgaggatgg aagcgatgag gagaccaact gctctattgc ctcatgcccc gccctgagct
     2341 gtgagttcaa atgcggaccc tcgctgacgg gtggagtgtg ctactgtaag ccgggccaat
     2401 cgctggctcc tgacaaccgg acctgtgtcg acctggacga gtgcgcggaa tggggtcact
     2461 gcgaccagct gtgcaccaac acactgggat cgtatacatg ccaatgcgcc cagggctaca
     2521 cgctcatcaa cgactccaag tgcatagctc cggatgcgaa taacttgcaa ctgatattcg
     2581 cccacgatcg tgccatcatg cgaatgctgc cgcatggcag tgagcccaag attttggcca
     2641 atgcaactgc cgcggcgggt gtgaccttcc attatgcccg gaacacactg tactggtcgg
     2701 acatcaagac gaggaaggtt caatcactgc cgctggatgc gcagaacaag gccgtctcgc
     2761 ccttcgatca gacccttccc ggcacctggg cgcccgtcgc tctggccgtc gactgggtgg
     2821 gcgataagat atatgtggcg gatttggtgg gtcagaagat cgatgtcttc gagctgagtg
     2881 gtcaatggca tgcggttgtt ctgggctcta atctcacctc acccgccgat ctggcactgg
     2941 atcccacggc tggtctaatg ttcgttgcgg atggcggtca ggtgctccgt gcccatatgg
     3001 atggcacaca tgccagatcg attgtctcgg aggcggccta caaggccagc ggtgtgacgg
     3061 tggacattat cagcaagcgt gtcttctggt gcgactccct gctggactac attgaatccg
     3121 tggactatga gggtgctcat cgggtgatgg tgctcagggg tcaacaggtt ccgagtccct
     3181 cgcgattggc tctgttcgag aatcgtatct actggacgga tgccaccaag cagggcatca
     3241 tgtcggtgga caagttcgag ggtcccacct ccattcaggt tacgtacaag gccaaggaca
     3301 tcagggagcc gaagggcatc attgctgttc atgcgctcag ccagcccaga gtatcgaatc
     3361 cctgtggcaa caacaacggt ggctgcaatc acatgtgcat tgtgaccgcc gtaaagggag
     3421 cacccactgg cctgggattc cgttgtgcct gctccacggg ctaccagctg gaaacggatc
     3481 tgaaactatg caagccagtc agtgaattcc tcatgtactc gcagcagaga ttcatcaagg
     3541 gaaaggtatt ggaaccggta attgaaggat ttagtgatgc catcatgccg gtggtttcga
     3601 ggcgtgctcg tttcgtcggt ctggatttcg atgcacgcga tgagttcatc tactactcgg
     3661 atgtgctgca ggatgtgatc tacagggtgc accgaaacgg aactggccgg gagatcgtct
     3721 tggcctctca gaatgaaggc gttgagggac tggccgtcga ttgggcctcc aagaatctgt
     3781 actacatcga ttcgcgcaag ggcaccttga acgtcctatc cacccgaaat gtgacacaca
     3841 gaagaaccct actgaaaaac ctgaaacgtc ccagggccat tgtggtccat cccaatcgtg
     3901 gtttcatctt cttctccgaa tgggaccgtc ctgcgaatat caccagagca aacacagatg
     3961 gtagtggttt gttggtgttc aaaaatgtaa ccctcggctg gccaaatgga ctatccatcg
     4021 acttcaagga ggatcgtgtc tactggtgcg atgctctatt ggatcacgtt cagcatgcca
     4081 acctggatgg cacggatatt aagacggtga actcacgact ggtgcgacat ccgttctcca
     4141 ttgtcattca caacgattgg atgtatatca cggactggcg cctggatgcc attatacgtt
     4201 tgcacaagct tacgggcgag caggaggaga tgatggtcag agagccgcag accaatagac
     4261 tgtacggcgt taaggtgtac agtcatgagg tccagaggat cgcggacacg caaccttgtc
     4321 acaggaacaa tggtggctgc cagaagatct gtttcgctgt tcccatcgga gcatcaaatg
     4381 gtaccgatgg ggtgaccact tcgtcgccct cgttcggtcg cctacagtcg cgctgctcgt
     4441 gtccctatgg cgaacgattg gccgacgacc aggtgagctg cattcccgat cccagtgccg
     4501 agccaccagt gcaaccctgc ccgaactcat gggactttac gtgcaacaat cagaggtgta
     4561 ttcccaagtc gtggctatgc gacggtgatg atgactgtct ggataacagt gatgaggagc
     4621 agaactgcac aaagcccact tgcggatcca acgagttcca gtgtcgatcg ggtcgctgta
     4681 ttccgcagaa cttccgttgt gaccaggaga acgattgcgg tgacaactcc gatgagcagg
     4741 agtgcggcaa tgtgacctgt ggaacgtccc agtttgcctg tgccaatgga cgctgtattc
     4801 ccaatatgtg gaaatgcgat agcgagaacg attgtgggga tagcagtgat gagggtgact
     4861 tctgtgccga aaagacctgc gcctatttcc agttcacgtg cccgcgaacg ggtcactgta
     4921 ttccacagag ttgggtttgt gacggcgacg atgattgctt tgacaaacag gacgagaagg
     4981 attgtccacc gatatcctgt ctggcgaatc aattcaaatg cgcggatcta aggcaatgtg
     5041 tagaggagtc ctacaaatgt gatggcatac cggactgtaa tgatggctcc gatgaggtgg
     5101 gctgtccttc catgggacca aatcagtgta acctggagaa gcacttccgt tgcaagtcca
     5161 ctggcttctg tattcccatc gcctggcact gtgatggctc caatgattgt tcagatcatt
     5221 cggatgagca ggattgtggt cagatcacct gtgcccagaa cttcttcaag tgcaacaaca
     5281 cgaactgtgt atttaaggca tacatatgcg atggcaagga cgattgcggt gataattcgg
     5341 atgagggagc tgaacacgca tgtgtcccac ccccgttcaa gtgtccccat ggtcagtggc
     5401 agtgtcctgg cgtttccgag agatgcgtga acatcacatc tgtctgtgat gatacgcccg
     5461 attgtcccaa tggttcggat gagggtgagg gctgcgattt ggccgagtgc gaacatcagg
     5521 cgggtcagtg ctctagcttc tgtcagaaga cccccaacgg tgcgttgtgt gtgtgtccac
     5581 ctggttcgga gatcggcgaa gatggctaca cctgcataga tagcaacgag tgcgatccac
     5641 cgggtctctg ctctcagcaa tgtaccaaca ccaagggctc ctacttctgc tcctgcacag
     5701 atggctatgt tctcgagccg aataagcaca cttgcaaggc agtaaaccac accgccgcct
     5761 tcctaatcat ctcaaatcgt cactccattc ttgtggcaga tctcaaggaa cagggactcg
     5821 agagggtgcc catcatagtg gaaaatgtgg tggccactgc ttccaatatg cacacaggca
     5881 ctattttctg gagcgacatg aaactaaaga agatctcccg attagatcgc ggtatggagc
     5941 cacaggaaat cattaacacg ggcctagact tggtcgaggg cctggcctat gattggattg
     6001 cccagaatct ctactggctg gacagcaaac tgaacaccat cgaagtgtcc gcggagaacg
     6061 gttccaatcg tctggttttg gtcagggaaa acatcaccca accaagaggc atgtgcatcg
     6121 atcccagtcc cggagcaaga tggatcttct ggactgactg gggagagaac ccaagagtgg
     6181 agagaattgg catggatggt actatgagaa aaacgatcat caataccaag atctactggc
     6241 ccaatggctt aactttggat atagcaacaa agagggttta ctttgccgac tccaagctgg
     6301 actttattga tttctgctac tacaacggca ccggtagaca gcaagtcctg gccagtagtc
     6361 actatctgct gcatcctcac tcgttgtcct tgttcgagga tacgctctac tggaccgaca
     6421 ggcaattgaa tcgagtgttg tccgccaata agttccgtgg caagaatcag accgtcgttt
     6481 cccacctgat aagtcaaccc ttgtccatcc acgttcatca cgcttccctg cagcccatga
     6541 ctccgaatcc ctgcgccgga tcacgctgcc agcacttgtg tctgctgagt cccagtgccc
     6601 cggagggtta ctcctgtaag tgcaggccgg gctttaagct cctgagcgaa ggtcgttgca
     6661 tcgaggagga gaatcccttc ctcatggtcg tcaagggtac acaaattgtg gatcttcctt
     6721 tgaatggtgg cgatgcgaga gccggagctc tggccccagt tattggaatc gaaagcagca
     6781 cgggcttgga ctttgatcgc aaaggagaga cgctctactg ggtgcagggc agggaggatg
     6841 atgatgagaa ctgcaccatc tatacgacac cctatggtgg tggcaataag acactcttcc
     6901 tgggtatcga aaatggaatt gtgggtgcac cctacaccat tgcattcgat tggctgggca
     6961 gaaatcttta cattggcaac cgggtggcca gcaacattga agccgtgcgc gtggatggca
     7021 agcaaaagta tcgcaccata atcctggcca acgatggtta tcccaactcc gtgtcgcggc
     7081 ccaaacaaat tgcactagat cccaccgaag gtaagctctt ctggatcgac gaaggagttc
     7141 tggaagtgcc cattaaaatt ggcagagttg atatgaatgg acagaatccc attgtagtct
     7201 tccaggagtt tgcccatccc gaatcgttgg ccgtggacac ggagaagaaa atggtgtact
     7261 acagtgctag caatccagcg gtgatcggtg tcatggacta caatggtgac gatcatacac
     7321 tgatcttgat gaaggactcg catccgatgg ccaagcccag gagcttgggc atcctagacc
     7381 ataggcttta ctacctggat ccgttgtacg agcgtattgt gaggattgat ctgccgcacg
     7441 gtgataatcc caagaccatt gtcgacaacg agtccgatct gcggtcgatg atgatctaca
     7501 agaagcgcgc cctgatgcaa catccctgcc agacgaacaa cggtggctgc aagcaccttt
     7561 gcattcccgg acctggtgca accagaacgt gtgcctgcgg cattggatac agaaaggaaa
     7621 acgagatcaa ctgcgtggcg tataagatct ttgccgtggt ctcccaactg gacatgatca
     7681 ggggctatag cttgagcgat agctccgagg cgatggtacc gataagcgga cctggccacc
     7741 acattctcca tgtggatgtg atgtatcgcg agcaatggat ctactgggcg gagtacaatc
     7801 gtggctactg gaatggcatt ttcagatcgc gacccaatgg caccgatctg cagcatgtgg
     7861 tcaaggatgg catcggcagt aatggcatca ggggtttgac catcgattgg gtggccggca
     7921 atatgtactt caccaacgtc tatccccatg agaattatgt ggaagtttgc tggctggatg
     7981 gtagcaatag gaaagtgttg gtgaagacaa ccacagatgc accacgtgaa ctggccgtga
     8041 atcccattaa gaggctactc tattggatcg actatggcca gcatcctagg attggaaaag
     8101 ccctcttgga tggcagcaaa tggacaccac tggtgacatc gggcatttcg ttgcctcgcg
     8161 atctaaccat tgacatgcag acccatgaca tctactgggt ggactcgaaa ctggacacca
     8221 ttcagaagat ttcgtataat ggcgccaatc gcaagataat ccgcagagat ctgcccaacc
     8281 ccatgggcat tgctgtctat ctgaacgatg tctactgggt ggataggaat ctgatgaccg
     8341 tgttcaaggc ctccaagcat agtgccaatg aaactgccac cagcgtgaga acgaatctgg
     8401 aaaagcttag ggacatcgcc atatacaaca tcaacaatca gccgcaggac gatacaaatc
     8461 catgtgcgca tttaggaaac ggtggctgtg atcagttgtg tttcagtttc ccaccggatg
     8521 gcggagcctc cggtacctca ggaggaagga atttccgttg cgaatgtgcc actggaaaac
     8581 tgagcgccga tgaaagaaag tgtgaggtgg tcaacgagta cctagtcttc gccacaagaa
     8641 ctgaaattcg agctgtcaat cttgatcccc attccacgga agttcccttc actccactga
     8701 caaatctcac aaatgtcgtg ggtctggact ttgattttgc ccacaaccga atgctgtata
     8761 cccaaatccg tccgtgggcc aagattgcgt acaccaaggc gaataagccg gggcacgatg
     8821 acatcactgt ggtcctgaac aagggcatta atcccgaggg cattgcctac gattggaccc
     8881 agcagaaaat ctactggact gatagctcga acaactcgat ctatgccatg aatttggatg
     8941 gtagcgaact ggttatgatt gcccgcgttg aaagaccgcg agctattgtc ctcgatccct
     9001 gcaatggcac gctattcttt acggattggg gcaggttcgg tacgtctggc aagattttcc
     9061 gcaccaccat ggcgggttcc ctgaagagag ccattgtcga caaggatctt tcgcagccaa
     9121 gtggcttggc tatcgattat gatgagagac gcctatactg gacggatgcg gtgagagaga
     9181 agatcgagag atccgatctg gacggtcaga atcgagagct tctggtggca gccaccattt
     9241 atccgttcgc cataaccgtg ttcaggaact acatctactg gacggatctt cagctgagag
     9301 gtgtctatag ggctgagaag cacactggag ccaacatggt ggagatggtg aagcgattgg
     9361 aggattctcc gcgagatatt cgcatctaca gttccgatcg ccaaaagtgc aatgtgaatc
     9421 cgtgcaggat caacaacggc ggatgtgccc agagctgtca tcctgccccg aatggcaagg
     9481 ccgagtgcaa gtgcgacgat agcaccaagg tggtgaacga gggaaggatg tgtgccccgc
     9541 gaaacaatac ttgcgaggcc agcaaattct actgcaagaa cggcagatgc atttcgagaa
     9601 tgtggtcctg cgatggcgac gacgactgtg gcgacaactc cgacgaggat cccaactatt
     9661 gtgcctatca ctcctgctcc cccaacgagt tccgctgcaa caacggacgc tgcatcttta
     9721 agtcgtggaa gtgtgatcac gagaacgact gcaaggatgg ttccgatgag ctgggctgcg
     9781 tctatccacc atgtgtggat ggtgagttca cttgcgccaa tggacggtgt attccacagg
     9841 ctcaggtgtg caatggtgtg aatgactgca aggataatgc cacatcggat gaaacgcacg
     9901 aacggtgtcc catgaacacc acttgtccgg cgaatcatct gaagtgcgag aagaccaaca
     9961 tctgcgtgga accctattgg ttgtgcgatg gcgacaacga ttgtggtgac aactccgacg
    10021 aggatccact gcattgtggc caacgaactt gtccaaccaa cagtttccgg tgtcccaacc
    10081 accgatgcat tccagctacc tggtactgtg atggtgacga tgactgtggc gatggagccg
    10141 atgaaccacc agattactgc aaatcggaag gacgcacatg cttcggggat ctgttcacct
    10201 gcgacaatgg caactgcata ccaaggatct acatctgcga tggcgacaac gattgtttgg
    10261 acaacagtga cgaggataac cggcaccagt gcaatgaccg taagtgtgat gaggaaacgg
    10321 agttcacttg tgtggagaac aaatcctggc agcgtgccca gtgcataccc aaaaaatgga
    10381 tctgcgatgg tgatccggat tgcgttgacg gagccgatga gaatactact ctgcacaatt
    10441 gtgccaccca gcagccctgt ggcgaggata tgttcacctg tggcaatgga cgttgcatca
    10501 ataagggatg gatctgtgac catgacaacg attgcggcga tggtaccgat gaaggcaaat
    10561 tctgtaactc caagtacaag acctgttcgg cccaggagtt cacctgccag aacttcaagt
    10621 gcatccgaaa tcaatcccgg tgcgatggcg aagacgactg cggtgatcac tcggatgagg
    10681 tgggctgtgc caaggagaac ataacctgtc cacagggtca gttcgcctgt acgaatggtc
    10741 agtgcatcga ctacaatctg gtgtgcaaca agtatccgga ttgtgccgac gagtccgacg
    10801 aacctgccca ttgcaacgtg gatgagtgcg ccaaggtgga gatcaatcag tgtggccaca
    10861 agtgcgtgga cacgctgaca ggttactact gcgactgcaa tgagggctac aaactgctag
    10921 ccgatggcaa agcctgtgcg gatgtggatg agtgcctaga gcagccgggc gcttgttctc
    10981 agcactgttc caataccccg ggtggattct actgcaagtg cgacgagacc tactacgaaa
    11041 ggcagaacga tgagcacacg tgcaagcgta aggacaagat cccaccgtgg ctgatcttca
    11101 ccaacaagta ctatgtgcgc aatatgtcgg tggatggaca tcagtacaat cttatgcacc
    11161 aggatctgat gaatgtggtg gctctcgact tcgatatacg cgaggaatac atgtacttct
    11221 gtgatgtcac ggccaagacc atcttcagag cgaagtatgg agaggccgat gacgagatgc
    11281 cgccggagag ggaggctgtc atcaggcacg attcccatgg cctggagggc atcgccatcg
    11341 attgggtggg tcgcaaactg tactggctgg acaggcactc caagaacctg gatgtctccg
    11401 aattggacgg cagcaagcgc aagacactga gaagtggcgt cgtcgatccg cgtgccatcg
    11461 tcgtgcatcc tggtatcggt tacctgtact tcacctcctg gcatctgcaa gcctatattg
    11521 ccaaaatggg catggatggt tcgaacttct cgagaattct aaactggaac gatggcatcg
    11581 cctggccgaa tgctctgtcc attgattact tcacggatcg aatttactgg gcagatgctc
    11641 acttggacta catagcatat gctgatctgg agggcagaca tcgtcatacg gtgctctcag
    11701 gaagcaaggt gcctcatgtg ttcgcactga gtctcttcga cgactacatc tactggagtg
    11761 actggaattt aaaggcgatc gtgagggcca acaagttcca tggtgcgaac tatacggtgc
    11821 tgaggaatac cacccatcga ccgtatgacc tgcacatcaa tcatccgctg agacagttgc
    11881 cctacaccaa tccgtgtggc acaaacaatg gcggttgctc acatctctgc ctgattgctc
    11941 cgccgccgga atccacctat ctgaacatcg agggatatat cgaggagggt gcaccaatct
    12001 tcaagtgtgc ctgtcccaat caattctatt tggccagaga catgaagacc tgcgtggcca
    12061 actgtacggc cggacagcat ttgtgtggcg gacgagatga gaagtgcatc ccatggttct
    12121 ggaagtgcga cggtgagaag gactgcaagg atggctccga tgagcccgct acctgcgctc
    12181 ctcgacactg ccgtgctgga acgttccagt gcaagaacac caactgcaca ccatcggcga
    12241 ccatttgcga tggagtggat gactgtggcg atcgcagcga tgaacaaaat tgcgatctac
    12301 cctgtccact atccgatttc aagtgcaagt ccagcggcag atgcatcctc gatagttggc
    12361 gctgcgatgg agatgccgac tgcaaggatg gcagcgatga ggatccagcc gtctgcttca
    12421 agcgaacatg tgatccgaaa accgagttct cctgcaagaa tggccgctgc attccgcaat
    12481 tgtggatgtg cgatttcgac aacgattgtg gcgacgactc cgatgagccg gcgtatatgt
    12541 gccgtcaaag gaactgcacc accggctggc agaggtgtcc cggccagtcc aactatcgct
    12601 gcattccgaa gtggctgttc tgcgatggca aggacgattg tcgcgacaac agcgatgagc
    12661 tgcccgagaa ctgtcccaag tgcaatccgg aaacggactt caagtgcggc aacaaccgat
    12721 gcatacccaa gcaatggatg tgcgatttcg cggacgattg tggcgatgcc agtgacgaga
    12781 atgaggcagt gtgcaaagga cgctatcggg agtgctccga atcggagttc cgttgcggca
    12841 atggcaagtg catatcatcc cgctggcagt gtgaccacga ggacgactgt ggcgataact
    12901 cggacgagat gcactgcgag ggataccagt gcaagaatgg caccttccag tgcgcttccg
    12961 gtcactgtat tgcctcctac ttccggtgcg atggcgatcg cgactgccgc gacatgtccg
    13021 atgaggtggg ctgtccgccc agattccccg gcggtcgcta ttgtcctgaa tcgcgtttcc
    13081 agtgcaacaa caacctgtgc gtttcgctgt ccgatttgtg cgacggcacc gatgattgcg
    13141 gcgatggcag tgacgaggat cccagcgttt gcagtgactt taactgcgat accctgcgac
    13201 gattccagtg ctccaatgag cgctgcgtgg cccgctatca gatctgcgat ggcgtggaca
    13261 actgcggcga tggcagcgat gagaacaaca tgaccctatg tgccagcaaa cagaagccct
    13321 gcgatctgta cacgcagtac cagtgtgcca acaagcattg catcgagcgg tcccaggtgt
    13381 gtgatttctc cgacgattgt ggcgatgcta gtgatgagtt aggatgccac cacacgagca
    13441 gttgctccga agcgaatcgg ggtggatgcc agcagcattg ccacaatcta acggatggtg
    13501 gatacatttg cacctgctat ccgggctaca tcatagccgc cgacaacaag aagaagtgct
    13561 ccgacgtgga cgaatgcctg acgcgacagc acacgtgctc ccaccaatgc cacaatctga
    13621 atggcaccta ctcgtgcagt tgtcgcgaag gattccatct gacggacggc gccagcggcg
    13681 tatgccgtgc cgaaaaggag gatgtcattc tcctgtttgt taatggtcag gagatcagag
    13741 gtctgaattg gcataagagc gaggagttcg ctgtgatagc ggcggagaag aggatcgagg
    13801 cactggacta cgatgcgcag caacagatcg tcttctgggc ggatagctat gacaagacca
    13861 tcaagcgatc ctacatggtc aatgccatcg atggcagggc caagatcgga ttcgcccagg
    13921 acctgaacat gaagggcggc tcgaagccca ctgctgtggc tgtggactgg ctggcctcga
    13981 atctctactg gaccgaaatg gacaggacgg gctcgaagcc gcgtggacgt gtcatggtgg
    14041 ccaagaccga tggtcgctat cgtcgctcga tcgtgaatgc tggactcgag gtacccacct
    14101 cgattgctgt gaatccgcag ctgggcagaa tatactggtc ggatgcggga tcagctccca
    14161 aaatcgaggt atcctggatg gatggctcta agcgccgccc actgatcacc gagatgatac
    14221 gacatcccgc cggcctgacc atcgactact cgcaggatca catcatatac tgggtggaca
    14281 ccaagctgaa tgccatcgaa tcgatgagag ccgacggctc gcgccgaaag gccattgtgc
    14341 ggggcgatca actgaggcat ccggtgtctc tggatctctt cgagtcgaac atgttctgga
    14401 tgacccgcga tacgggtgag ctggtgcgcc aggataagtt cgggcgcgga gtgcaggtgg
    14461 tgctgcatcg ctatatcgtc aatccgtccg gcctgaaggt gtaccacgac aagcggtaca
    14521 acacctcgct gcccaatccg tgcgacaact ccacctgctc ccacctgtgc ctgctggtgc
    14581 cgggcggcca tcgttgtgcc tgtccagacg cctctggacc gccgccctcg caccgcagca
    14641 ccgccgaggt catctgcaat gctgccgccg agcatccgcg cccggctccg cgaatctgcc
    14701 cctgccagaa tggtggactc tgcaaggagg acgcccaggg tgaactgctg tgcgagtgcc
    14761 gaacccagtt cgttggcgag cactgcgaga caagcacgat gggagccttt ggccatggtg
    14821 acgctaatgt caccgccgtc gtggtgccca tcatggtcat cctgctggtg atgatggccg
    14881 ccgctggcgc ctggtatgtc atccgcaagc gaccatttgg caagctggct cgcatgccgg
    14941 cgatgacctc gtcgcagagc gtgaccttcc gtcacggttc gaatgtggag ttcaacgaga
    15001 gcggcttccc aggagcatct gcgccgggag ctggcgatgt ggcgcccatc gagggctaca
    15061 acctgcagac ggtgaacgcg aacaaggcgc gcgactttgc caatcccatg tacgatgcag
    15121 tccaatcggg caccaccgcc gatccgggca tgggcaatgg ttcgggcatt tatgatgtgc
    15181 ccggcgagcc gtcggccaag gtcaagtcca tgggccacca tgcgggcggt tcgttcacgg
    15241 aacccgcctc ggcgatcatc gcgcccagca gcattacgca caaggcgtcg ccgcagctgc
    15301 agctgcgcac cagggagcta gatccttcgg cggacaccgg caaggacacg cagttcctgg
    15361 tggaggagga taagtccgag tgctgatatc aagcccgtca atcggctgtc gttgcggcgg
    15421 cagttgcgat ggccagttgc cgccaacagc gccggcagca tcagcagcag cagcatcccg
    15481 agaacagcta tccgctgcag acataacaca tactggtcaa gcagaggagg gagcagcatc
    15541 agaagcagca gcatcagcaa cagcagcaac atcagcagca gggacaggga cgttctagta
    15601 gtaaacatca caaatcctgg caggtagcca ccgctggcaa ggtcaccacc aaggtctagc
    15661 cgtgacccca acagaaaaca cacaccaccc acagagagta gcaacacgat caggaggaga
    15721 agatgcagga ggaggaggag aaggatcagc agaaggagga gtagcaagtc ctcggggact
    15781 ggggacgcca ataagcaaac atatccaaaa attgataaac atatgcaacc ccccacagga
    15841 gaaaccaact