Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001297972 1655 bp mRNA linear INV 26-DEC-2023 (Tre1), mRNA. ACCESSION NM_001297972 VERSION NM_001297972.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1655) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1655) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1655) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1655) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1655) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1655) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1655) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1655) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1655) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1655) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1655) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1655) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1655) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1655) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1655) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1655) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1655) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1655) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1655 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1655 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="Trapped in endoderm 1" /map="5A11-5A12" /db_xref="FLYBASE:FBgn0046687" /db_xref="GeneID:140439" CDS 320..1519 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="CG3171 gene product from transcript CG3171-RC; CG3171-PC; Tre1-PC; trapped in endoderm-1; scattershot; G protein coupled receptor; trapped in endoderm 1" /codon_start=1 /product="trapped in endoderm 1, isoform C" /protein_id="NP_001284901.1" /db_xref="FLYBASE:FBpp0309197" /db_xref="GeneID:140439" /db_xref="FLYBASE:FBgn0046687" /translation="MDQDMGMATGYFQDADMQMDEPAAATQSIYPHSATLFAAISACV FVTIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESW TFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFV WAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSY SCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTI FLCFLVCFLPLMLANVVDDERNTSYPWLHIIASVMAWASSVINPIIYAASNRNYSESI FYFRVAYYKIFALLKFWGEPLSPMPSRNYHQSKNSKELSGVIRSTPLFHAVQKNSINQ MCQTYSV" misc_feature 428..1342 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="G protein-coupled receptor 84 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Region: 7tmA_GPR84-like; cd15210" /db_xref="CDD:320338" misc_feature 428..508 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 1 [structural motif]; Region: TM helix 1" /db_xref="CDD:320338" misc_feature 530..601 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 2 [structural motif]; Region: TM helix 2" /db_xref="CDD:320338" misc_feature order(596..598,605..610,644..661,665..670,677..679, 812..814,818..832,902..904,911..919,923..931,935..940, 1169..1171,1178..1183,1187..1192,1199..1201,1220..1225, 1229..1237,1244..1246,1253..1258) /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="putative ligand binding pocket [chemical binding]; other site" /db_xref="CDD:320338" misc_feature 644..736 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:320338" misc_feature 776..832 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:320338" misc_feature 902..979 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:320338" misc_feature 1109..1201 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:320338" misc_feature 1223..1300 /gene="Tre1" /locus_tag="Dmel_CG3171" /gene_synonym="anon-WO0170980.16; anon-WO0170980.17; anon-WO0170981.1; BEST:LD12308; CG 3171; CG3171; Dmel\CG3171; LD12308; sctt; Tre; TRE; tre-1; Tre-1; tre1" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:320338" ORIGIN 1 tcatttcgtt tgttgttctt gttgccgctg ttgttaattg acgacagtga aaatacgaca 61 ctttgcgctc tgcgatcggt tagttaagtt ggcttagttg gcccaagcag cgcttctgtt 121 tcgataattc aaaagtcgga attgtgagaa ggccagaatc ggctggttgt atttattttg 181 ttccgtttat ttttgttact gtgctgcgcg gagcgattta atgtcaaatc caaaatgcaa 241 ttcgaaagca tttaagaaac gccaaacgaa gtataaattt ataataagcg gaaaacagtg 301 aaacgggttc gagttcggaa tggatcagga catgggcatg gcaacgggct actttcagga 361 cgcagacatg cagatggatg aaccggcggc cgccacgcaa tcgatctacc cgcattcggc 421 gacattattc gcggccatta gtgcctgtgt ctttgtgacg atcggcgttc ttggcaacct 481 gattaccctg ctggcgctgc tcaagagccc cacgatacgg gagcatgcca caaccgcctt 541 cgtcatttcg ctaagcatct ccgacctgct cttctgctcc ttcagcctgc cactgaccgc 601 agtgcgattc ttccaggaga gctggacttt tggtaccaca ttgtgcaaga tctttccggt 661 gatcttctat ggcaatgtgg ctgtttcact cctcagcatg gtgggcatca ccctgaacag 721 atatatactc atcgcttgcc acagccgcta ctcgcagata tataagccta agttcataac 781 cctgcagctg ttgttcgttt gggccgtctc ctttctgctg ttgctgccgc ccatattggg 841 catctggggc gagatgggcc tggacgaggc caccttctcc tgcacaatac tcaagaagga 901 ggggcgatcg atcaagaaga cgctgttcgt gatcggcttc ctgctgcctt gcctggtgat 961 catcgtttcg tactcgtgca tctacattac ggtgctgcac cagaaaaaga agattcgcaa 1021 ccacgataac ttccagatcg cagcggccaa gggctcctcg tcgtccggcg gcggatccta 1081 catgaccacc acatgcacgc gcaaggcgcg cgaagacaat cgactgaccg tcatgatggt 1141 caccatcttt ctgtgcttcc tcgtctgctt cctgccgcta atgctggcca atgtggtgga 1201 cgacgagcgc aatacctcgt acccctggct gcacatcatc gcctccgtga tggcctgggc 1261 ttccagtgtc attaacccga tcatctatgc ggccagcaat cgcaactaca gcgaatctat 1321 cttctatttc agagtggcct actacaagat ctttgcgctg ctcaagttct ggggcgaacc 1381 gttgtcgccg atgccgagta gaaactatca ccaaagcaag aactccaagg agctgtcggg 1441 cgtcatccgc agcacgccgc tgtttcacgc tgtgcagaag aatagtatta accaaatgtg 1501 ccaaacatat tcagtatgat cgagctcgca gtcgagagct tgtaattcat atcaattacc 1561 tacttattac ttgttagttc ataattattt acgatgtatg gccgtgctta catcaaagac 1621 aatcgaatta aatacatata cgtagaccaa ttgag