Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster Sex peptide receptor (SPR), transcript


LOCUS       NM_001297964            3357 bp    mRNA    linear   INV 26-DEC-2023
            variant B, mRNA.
ACCESSION   NM_001297964
VERSION     NM_001297964.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 3357)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3357)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3357)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 3357)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 3357)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 3357)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 3357)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 3357)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 3357)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 3357)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 3357)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 3357)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 3357)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 3357)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 3357)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 3357)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 3357)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 3357)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3357
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..3357
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="Sex peptide receptor"
                     /map="4F11-5A1"
                     /db_xref="FLYBASE:FBgn0029768"
                     /db_xref="GeneID:31463"
     CDS             299..1606
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="CG16752 gene product from transcript CG16752-RB;
                     CG16752-PB; SPR-PB; Sex peptide receptor; SP receptor"
                     /codon_start=1
                     /product="Sex peptide receptor, isoform B"
                     /protein_id="NP_001284893.1"
                     /db_xref="FLYBASE:FBpp0308828"
                     /db_xref="GeneID:31463"
                     /db_xref="FLYBASE:FBgn0029768"
                     /translation="MDNYTDVLYQYRLAPSASPEMEMELADPRQMVRGFHLPTNESQL
                     EIPDYGNESLDYPNYQQMVGGPCRMEDNNISYWNLTCDSPLEYAMPLYGYCMPFLLII
                     TIISNSLIVLVLSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHP
                     VSMCLAYSIFNEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAY
                     IALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFR
                     VLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRETNCTTLMLIVV
                     VSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGM
                     SRQFRETFKEIFLGRLMAKKDSSTKYSIVNGARTCTNTNETVL"
     misc_feature    566..1498
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="FMRFamide (Phe-Met-Arg-Phe) receptors and related
                     proteins, member of the class A family of
                     seven-transmembrane G protein-coupled receptors; Region:
                     7tmA_FMRFamide_R-like; cd14978"
                     /db_xref="CDD:410630"
     misc_feature    569..649
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410630"
     misc_feature    665..742
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:410630"
     misc_feature    order(731..733,740..745,800..817,821..826,833..835,
                     968..970,974..988,1103..1105,1112..1120,1124..1132,
                     1136..1141,1319..1321,1328..1333,1337..1339,1349..1351,
                     1358..1360,1397..1402,1406..1414,1421..1423,1430..1435)
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="putative ligand binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:410630"
     misc_feature    800..892
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410630"
     misc_feature    926..988
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410630"
     misc_feature    1103..1180
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410630"
     misc_feature    1262..1363
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:410630"
     misc_feature    1400..1477
                     /gene="SPR"
                     /locus_tag="Dmel_CG16752"
                     /gene_synonym="CG12731; CG16752; Dmel\CG16752; DrmSPR;
                     SP-R; spr; Spr"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:410630"
ORIGIN      
        1 agttgagctt tagcttttga cgtataaaga agtgtctaaa gtatagtgca aagctaaaat
       61 tttgtcagat ttaccaagtg caaggtggga aaatgttgaa gccagtcata aattaggttt
      121 agtttttaca gaggatacga aatgaataat gtttttaaat ggaaaaatgt atggcgtttt
      181 tgagcagcag tacaactagc gccagcatat agatcacgga aaatgcctga tttgcgagct
      241 gcaattgaga attaaggcag cgccagggga atccgctcga gaaacccacg tccacgagat
      301 ggacaactat acggacgtac tgtaccagta ccgcttggca ccgtccgcca gcccggaaat
      361 ggaaatggaa ctggccgatc cgcgtcagat ggtccgcgga tttcatctgc caaccaacga
      421 gtcgcagttg gagattcccg actatggcaa cgagagcctg gactatccca actaccagca
      481 gatggtcggc ggaccgtgtc gcatggagga caacaatatc agctattgga atctcacctg
      541 cgattcgcca ctggagtacg ctatgccgct ctatggctac tgtatgccct tcctgctgat
      601 catcaccatt atctcgaact ccctgattgt gctcgttttg agcaagaaga gcatggccac
      661 gcccaccaat tttgtgctaa tgggaatggc tatatgcgat atgctgacgg ttatatttcc
      721 ggcacccggt ctctggtata tgtacacatt cggcaatcat tataagcccc tgcatccggt
      781 ctccatgtgt ctggcctaca gcattttcaa tgagataatg ccagccatgt gccacaccat
      841 ctccgtttgg ctaactctgg ccctcgccgt tcaaagatac atctacgttt gccacgcccc
      901 catggcccga acgtggtgca cgatgccgcg tgtgaggcgg tgcacggcgt atattgcatt
      961 gctggcgttt ctgcaccaac tgcccagatt cttcgacagg acgtacatgc cgctggtgat
     1021 cgagtggaac ggcagcccaa cggaggtgtg ccacttggag acgtcgatgt gggtgcacga
     1081 ttacattgga gtggacctat actacacaag ctactatctg ttccgggtgc tgttcgtcca
     1141 cctgctgccc tgcattatcc tggttaccct gaacattctg ctgttcgcgg cgatgcggca
     1201 ggcacaggag cgccgaaagc tcctcttccg ggagaaccgg aagaaggagt gcaagaaact
     1261 gagggagacc aattgcacca cgctgatgct aattgtggtc gtgtcggtgt tccttctagc
     1321 cgagataccc attgctgtgg tcactgcgat gcacatcgtc agtagcctga ttatcgagtt
     1381 cctggactat ggactggcca acatttgcat catgctgacg aacttcttcc tggtattcag
     1441 ctatccgatc aacttcggca tttactgcgg catgtcgcgc cagtttcggg agactttcaa
     1501 ggagatattc ctcggtcggc tgatggccaa aaaggatagc tccacaaaat actcgatcgt
     1561 taatggcgcc cgcacctgca ccaacaccaa cgagacggtc ctctagtaat tggtgatgtt
     1621 ggtgccgcgg cggggcagca gcgaccatcg tcgcagctcc actagcacca ccaccaccac
     1681 caccaccaag accattggtg ggtcaatgat catcggtggt gaggcctcgg cgcagcacca
     1741 gcatctggta acgcaccatc tgcagaccca ctcacagccc agtcagcagc ggcgggtcag
     1801 caccatggac atcatcaccg aggagcggat tttgtaaact ggatgcgaga atcggatggg
     1861 ttcggaatcg attgggtgcg gctatcggaa atcagagatc ccaatatact gttgaaaact
     1921 atcggctgcc tgccgaggag cgcaatttac aatacagttc tttattcgtc aatggtctca
     1981 gcatgaaatt ttaacagaat ttgcaattgc aactaatcca gcaaaaatca aaagaactcc
     2041 actacacaaa tggttttttt tcgaacagag ctaagaagta aggtttcagg agaaaactac
     2101 aatacatagg tacacaggaa cttgtttaat taaaaacact aatatatcaa tatcaaaata
     2161 accaaaaatg cgtagagtat ttggaatgat gcagtctgaa ttttgatgga ttttgcaaat
     2221 gagcgatttt cacttttaaa taacttaagg cagtttaaaa acgttaagaa atacatagat
     2281 atccccgggt agaccgaata acacccaaac cgaacattaa gtgtctgttc tattcccgcg
     2341 aataagacac aaatttctcc attcgaatct gtgtgtattt ctctgtgcgt tggtgtcata
     2401 ttcagattaa atattcagat tagtacttaa gctcatatat gtatatgcta tttttatggc
     2461 taagggtgta cgtctaagtc taagagatgc ggtgaaactt tcaagaagtg atagtggtag
     2521 ggtgaaagtg ctgggtgaag attttgggta acaacaataa cataatacta cagtaaagtt
     2581 aggaaaaata cttacaggaa actcacaagt cataactatc ggattgaaaa gcgaaactga
     2641 attaatcgaa ataatcgata gtattgacga ttagttttag cttctagggt atttacgaaa
     2701 ttttgaaaca atgcctgggt aaatatgttt atttgagagc aactttttgt gcgcccattt
     2761 gtaaaatatt tttgtatttt aactagggtt ctttagcgta gttagttgta ggatggaaaa
     2821 ctcgtttaaa ttcgtaaacc ttttgagccc cagtgtttac cgatttaaat gaaagttaag
     2881 aatacacaaa aacaaaaaaa aaaaaaatat ataagaacat aacaaatcag tcctaacgaa
     2941 tttcaactca atgttctagg ctacgcgtac gttttttttc tagtgtaagc aacagcatat
     3001 acaattgtaa tgcaatgtta atatgtgtac actcgtctaa cagttacaat tgcagtttcc
     3061 ggtttaaatg ttttcagtgt acacaaaact agttgactaa gcatacaact acggctaaag
     3121 ctaatactac aacttgaatt acaactacac aactatgaac tataaccata actatagctg
     3181 aaagttgtct gtctgaatgg aatgtgttaa ctatttatat gtattggtga cgaaagatac
     3241 ggtttccgtt tccgcttccg tttaatttga tttttaattc tgatgacgat tacgacctga
     3301 ttttgtatat atatttcgtc gggtgaatcc aataatgaat aaataaacta attaaat