Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001297906 6251 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_001297906 VERSION NM_001297906.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 6251) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 6251) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 6251) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 6251) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 6251) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 6251) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 6251) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 6251) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 6251) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 6251) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 6251) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 6251) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 6251) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 6251) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 6251) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 6251) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 6251) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 6251) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..6251 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..6251 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="roughest" /map="3C3-3C4" /db_xref="FLYBASE:FBgn0003285" /db_xref="GeneID:31290" CDS 541..2835 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="CG4125 gene product from transcript CG4125-RB; CG4125-PB; rst-PB; roughest; ChiasmC-roughest; irregular optic chiasma C; irregular chiasm C-roughest protein; irregular chiasm-C-roughest; C-Roughest; irreC-roughest; Irregular-chiasm-C; irregular chiasmC-roughest; irregular optic chiasma C/Roughest" /codon_start=1 /product="roughest, isoform B" /protein_id="NP_001284835.1" /db_xref="FLYBASE:FBpp0310320" /db_xref="GeneID:31290" /db_xref="FLYBASE:FBgn0003285" /translation="MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGAR VTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDD ARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGG KPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQN TADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQ VRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKS EDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTST NLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIEC FASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNC TVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPP ADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTT CSTKSNGSSTIMQNNHQNQLQLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSII GSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVDPR YSAIYGNPYLRSSNSSLLPPPTAV" misc_feature 625..870 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 673..687 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 808..822 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 850..867 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 943..1215 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="CD80-like C2-set immunoglobulin domain; Region: C2-set_2; pfam08205" /db_xref="CDD:400489" misc_feature 991..1005 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1033..1047 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1129..1143 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1171..1188 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1216..1227 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1351..1560 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1576..1773 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Immunoglobulin domain; Region: Ig_3; pfam13927" /db_xref="CDD:464046" misc_feature 1822..2112 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1876..1890 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1918..1932 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2011..2025 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2053..2070 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2092..2103 /gene="rst" /locus_tag="Dmel_CG4125" /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C; Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst; IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST; rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" ORIGIN 1 gcacttcgtt ccgttcgctc gtaccgttcg cttcgtagcg gcggaaactc cgtactttcg 61 atagctggta tctcacagat acttttcgag accccgaaga cgagaactcg catcgcatat 121 tcgcccgaga aaactctcag taaatctcag ataattaaaa cgaaatatat aactaaacgt 181 caattttttt tttggtgcaa acgcaagcca aaaaatttca ttttggtgtg gattaccagt 241 ggaaaagtgt gtgcttaaaa tggaataaac aaggctatca taaaaacaaa gcccgaaaaa 301 ccaaacaagc tgaaaattgt caacccaaca attatggatt agtgccagtg gccggtcaga 361 gtcagttaaa aatatatatg catataagag gactaaggag ccgaaattgt ttaaattgat 421 tacaaacaaa cagtatctca aggcccaaag gagcaaggag tagaaaggag gaaaataaag 481 aaaagtgaga aagtgacacc caagacttca gttctgtcat tgaaaaggtg ttgaagcaac 541 atgttgcaca cgatgcagct gctcctgctg gccactattg tgggcatggt caggagctcg 601 ccgtacacga gctatcagaa ccaacggttc gccatggagc cgcaggatca gacggcagtg 661 gttggggcca gggtaacgct accctgccga gtgatcaaca aacagggcac gctccaatgg 721 accaaggatg actttggact tggcacgtcc cgggatctga gtggattcga acgctacgcg 781 atggtgggca gtgacgagga gggtgactac tccctggaca tttatccagt gatgctggac 841 gacgatgctc gttaccagtg ccaagtgagc ccaggtcccg agggccaacc agccattagg 901 tccacattcg ccggattgac ggtgctcgtt ccgcccgagg cgcccaaaat cacacagggc 961 gacgtcatct atgccaccga ggatcgcaaa gtggagatcg agtgcgtttc ggttggcgga 1021 aagccggctg ctgagattac ctggattgat ggcctgggca atgtccttac ggataacatt 1081 gagtacacgg tgataccgct gcccgatcag cgacgcttta cggccaagtc cgtcctgcga 1141 ttgaccccca aaaaggaaca ccacaacacg aacttcagtt gccaggcgca gaacacggcg 1201 gaccgcacct atcgctcggc gaaaatacgt gtcgaggtga aatatgcccc caaggtgaag 1261 gtgaatgtga tgggctcgct tcccggcggt gcaggtggtt cggttggtgg tgcaggcggt 1321 ggcagtgtcc acatgagcac cggttcccgt attgtggagc attcgcaggt gcgcttggag 1381 tgccgggcag atgcgaatcc cagcgatgtc cggtaccgct ggttcataaa cgacgaaccg 1441 atcatcggcg gccagaagac agagatggtg atacgcaatg tgactcgcaa gttccacgat 1501 gcgattgtca agtgcgaggt gcagaattcc gtgggcaaga gtgaggacag cgaaaccctt 1561 gacataagct atgctcccag tttccggcag cgaccacagt caatggaggc ggacgttggc 1621 agcgtggtgt ccctaacctg cgaggtggac agcaatccgc agccggagat cgtctggata 1681 cagcatccca gtgaccgggt ggtcggcacc agcacaaatc tcacattcag tgtgagcaat 1741 gagacggctg gaaggtacta ctgcaaggcc aatgtacccg gatacgctga gatttcggca 1801 gatgcctatg tctatctgaa gggctcgccg gcgattggat cgcagaggac acagtacgga 1861 ctggtgggag atacggctcg gatcgaatgc tttgccagca gtgttcctcg agcccgtcac 1921 gtctcgtgga cgttcaacgg ccaggagatc agctcggaat cgggacacga ctattcgatt 1981 ctggttgatg ccgtgccggg gggcgtgaag agcacgctca tcattaggga cagccaggcc 2041 taccactacg gaaagtacaa ctgcacggtg gtcaacgatt acggcaacga cgtggccgag 2101 attcagctgc aagccaagaa gagcgtttcc ctgctgatga caattgtggg cggcatttcg 2161 gtggtggcct tcctgctggt gctgaccatt ttggttgtgg tctacatcaa gtgtaagaag 2221 cgcaccaagc tgccgccagc ggatgtgata agcgagcatc agatcacgaa aaatggcggc 2281 gttagctgca aactggaacc aggcgaccgg acctcgaact acagcgatct aaaggtggac 2341 atttcgggcg gctatgtgcc ctacggcgac tacagtacgc actacagtcc gcctccgcaa 2401 tacctgacca cctgttcgac gaaatccaat ggcagctcga ccattatgca gaacaaccat 2461 cagaaccaat tgcaactaca gcagcagcag caacagagcc accaccagca ccacacacag 2521 acgacgaccc tgccgatgac cttcctgacc aacagcagcg gtggcagctt gactggcagt 2581 attattggat cccgtgaaat tcgccaggac aacgggctgc ccagtctgca gtcgaccacc 2641 gcctcggtgg ttagctcatc gccgaatggc agctgcagca atcagagcac cactgccgcc 2701 accaccacca ccacccacgt ggtggtgccc agctcgatgg ccctgagtgt ggatccccgc 2761 tatagcgcca tttacggcaa tccctatctt aggtcctcca actcgtcgct gctgccgcca 2821 cccactgccg tttagggtgg accagcaccg tccaccacca acaccaccac caccaccact 2881 gccaacaaca acgatgaccc actgagccac gctaagactg atctcacaag gaaccgaggc 2941 cccggcggct gcttttgggg gggtatcact gttcgtggtg gtgcgttttt tcagctacca 3001 aaaattcgaa ttgcttaggt ttaggcactt agctcacata catccgatta tataggcata 3061 atcgtaagct gatctttagc atcatcattt ctatagtcct taggtctagg gtattttatt 3121 ttatgttttt tttttttttt gtcgtttttg tgttcttagc ttaaggatct tacagtaggc 3181 taatatcccc agtttgatct agagagagac taagcttcaa agaatgagtg ttaagcattt 3241 acagaacaaa aaacaaatct taggaagatt agaaagtttt actgcttgtt gagaaaacgc 3301 cgtaatgtac tagttaactg attggggatt taacctccag ttacaagaaa gaaaaaaact 3361 ggttttcttg ggggcgggga tatgcgagag ccgttttgaa catgttctct gatttcatat 3421 aatgtttcaa atattatttt cgattcaaat attatttccg tgtctcttat tctcaaaact 3481 taatgctctt ctatttttaa aaaatttgat tgctattttt tgtacagtgt acatgtgtac 3541 atgaaacttt agaactattt cgtaacgcgt aactctccca gagattttga aatcccaaga 3601 atattccttc gtcaaaaaca gctgccccta tataatccgc aaaaaatata tagaatggta 3661 attgaaagaa ttcaatttta tgtatacaca gctatagtat atgctaaatg ttaatgatat 3721 atatatatac aacaagcatg aagacattca gttgaatgga tagcgagtaa gcgaacgaaa 3781 tgccaaagta cctgatagta tttaagtagg gggtgggaaa gtctttggat cggtaccgcc 3841 cgccattaac ttcttctgaa ttatgtagca ttatcttttc tcgccggaat tctaagctat 3901 gacttgggat tcgatagtgt gttttacgat taaataaata tagaagctag atcttgacag 3961 tcgccttaac ttatgacacg cccatacatc tcaaaacgcc catgcaaata taggaaaaga 4021 aaacaaaaat gagagcgtaa acgtattcaa ttcgtcagtt caattgtgct aagtgtactt 4081 ctaagtgtat aacggtctaa ttatcctagt tgtagcctaa ctaatgatag acacgcatat 4141 ttaaagtata gaacctagcc ctagatatac atacatgcat tttttttcat aggcctaagc 4201 attatatttt gataagccag cgtatttcgt ctaaggagcc cctgaaaagt aaacattact 4261 atttcatttt gctatattta ttagctgtgg gtattttatt agtgtcgcca attaagcgcg 4321 aaacgaacaa atgttttttg tttacaaaat gcaaatgata aaagcaaata agcagcatga 4381 aacacacaca aagttaaaca cgaaaacaaa aagcaaaaaa aaaactgaat aaaaatttat 4441 tgaaaaaaaa aaaaaaaaaa aacagaaagc cgaggaaagc gaattgagag ttggacatca 4501 aagacgaaag acaaatatac ggtagggggc aaaaaacatt tttaatttgc ccaggtcgga 4561 aggaccaact gtcagttagc tgcaaaaagc caaaaatcaa acaaacaaaa gtgaaatgaa 4621 aatgttccac cactggcacc acttgcacca ccaccaccgc cagtcatgtg tgttaattta 4681 tggcaagtcg actcgccgtt gtcggagcta ctgcactgtg gaaaaaggtg ggtatatttt 4741 cgtatttaag aatgatttgg ctttcgagga taagcaagtg gtaaaataaa agaggttaaa 4801 ataagagaaa aaacgtcttt aactcttttc tgtatactag atttgaattc tattatgttt 4861 ttttgctatt gatttatttt aatttaattt taatttattc cagaaaacgc tttctaccat 4921 attttcactc agtgtgactg accagagttg tgaagttgac aatgcaaaca aacggctcgc 4981 taagctcgac taaaaatgct taatgagagt gcgtaagggt ggccccccaa ccgttgaacc 5041 acccaccagt tcaccactcc acccgcttcc ccctttccca ccccagccca ccagtttcag 5101 gacccttttt cgccgcccct tgaggcaagt gttggccgca agaaattctg cggctatggg 5161 caacaaagtc gcgcacgacg cccattaaac taaattagtt gccctttgtc accgaacgac 5221 cctcgctgtc acacgtggct cgctgggggc ggtggggtcg aatgttttgg ggcggcgggt 5281 ggttcgaaca tacgtgcact tagccagaag gaagttgcaa ttgcggttgg ctgtgttaat 5341 tagcgttttc tttttttcct cattgcgaaa gcgaagggga aactctcgaa aactgaaact 5401 aacgtgagtt ggcaaatgtc aagagactgg tgaaagtaaa gccacagaaa ctgacattag 5461 ttggaatcct tttcagaacc ctttatgaaa gtgcaccagc ttcacttcag tttctttaat 5521 gctaatgcta ctctactaag gcaatattca atgcaaagcc ttgtacacat tgatattcac 5581 tttgatatac ttgcatagga atattcaata tatttttcct cacatatgta tgcttatagt 5641 atttttttta tttattttgg aaaattgctt ggcgtttccc aagcccccaa cctcgttgac 5701 aattggcaaa agttgcgagt aagcttcttc agaaacagca attcgcattg tccgtgaagt 5761 cgtgcggagt tttgccggcg cgttaatcac tctgcaatcc aacatccttt cgggtttcag 5821 gttccctcgg ctcctctttg ggatgacttt ttttttcaag gggaggacgg aggacgggac 5881 tggagatggc gcaaaaaacg gacacgaggc gcccgaagag ttacgatttc attaacatga 5941 gatatggcaa ctgccaaagc gctggtcgct ccgaagcctt gggttttctt tttttttttt 6001 tgggtacagg attgggggtt tgtggttcgg ttcggttcgg ttcggttcgg ttcggggtcg 6061 gttcggttcg gggtcgttcc gggggtcgtg ttgggctggt ttatggctca agtgttggct 6121 tgtcgtcgcc gcttgtgtcg cactgcgttg ttaattgcta caaggagagt ggtcgaagga 6181 gcgacagaga caggtggatg gaaagcactc ggaaaaatca ttgacccact tggaaacatg 6241 ggatctcacg t