Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster roughest (rst), transcript variant B, mRNA.


LOCUS       NM_001297906            6251 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_001297906
VERSION     NM_001297906.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 6251)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 6251)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 6251)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 6251)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 6251)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 6251)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 6251)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 6251)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 6251)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 6251)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 6251)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 6251)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 6251)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 6251)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 6251)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 6251)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 6251)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 6251)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..6251
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..6251
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="roughest"
                     /map="3C3-3C4"
                     /db_xref="FLYBASE:FBgn0003285"
                     /db_xref="GeneID:31290"
     CDS             541..2835
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="CG4125 gene product from transcript CG4125-RB;
                     CG4125-PB; rst-PB; roughest; ChiasmC-roughest; irregular
                     optic chiasma C; irregular chiasm C-roughest protein;
                     irregular chiasm-C-roughest; C-Roughest; irreC-roughest;
                     Irregular-chiasm-C; irregular chiasmC-roughest; irregular
                     optic chiasma C/Roughest"
                     /codon_start=1
                     /product="roughest, isoform B"
                     /protein_id="NP_001284835.1"
                     /db_xref="FLYBASE:FBpp0310320"
                     /db_xref="GeneID:31290"
                     /db_xref="FLYBASE:FBgn0003285"
                     /translation="MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGAR
                     VTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDD
                     ARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGG
                     KPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQN
                     TADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQ
                     VRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKS
                     EDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTST
                     NLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIEC
                     FASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNC
                     TVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPP
                     ADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTT
                     CSTKSNGSSTIMQNNHQNQLQLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSII
                     GSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVDPR
                     YSAIYGNPYLRSSNSSLLPPPTAV"
     misc_feature    625..870
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    673..687
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    808..822
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    850..867
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    943..1215
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="CD80-like C2-set immunoglobulin domain; Region:
                     C2-set_2; pfam08205"
                     /db_xref="CDD:400489"
     misc_feature    991..1005
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1033..1047
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1129..1143
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1171..1188
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1216..1227
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1351..1560
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1576..1773
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    1822..2112
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1876..1890
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1918..1932
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2011..2025
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2053..2070
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2092..2103
                     /gene="rst"
                     /locus_tag="Dmel_CG4125"
                     /gene_synonym="CG4125; CT13684; Dmel\CG4125; IREE-C;
                     Irre-C; irreC; IrreC; irreC-rst; IrreC-rst; IrreC-Rst;
                     IrreC/Rst; IRREC/RST; IrrecC; irrecC-rst; Rst; RST;
                     rst-irreC; rst-irrecC; Rst/IrreC; rst/irrecC; UB883"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
ORIGIN      
        1 gcacttcgtt ccgttcgctc gtaccgttcg cttcgtagcg gcggaaactc cgtactttcg
       61 atagctggta tctcacagat acttttcgag accccgaaga cgagaactcg catcgcatat
      121 tcgcccgaga aaactctcag taaatctcag ataattaaaa cgaaatatat aactaaacgt
      181 caattttttt tttggtgcaa acgcaagcca aaaaatttca ttttggtgtg gattaccagt
      241 ggaaaagtgt gtgcttaaaa tggaataaac aaggctatca taaaaacaaa gcccgaaaaa
      301 ccaaacaagc tgaaaattgt caacccaaca attatggatt agtgccagtg gccggtcaga
      361 gtcagttaaa aatatatatg catataagag gactaaggag ccgaaattgt ttaaattgat
      421 tacaaacaaa cagtatctca aggcccaaag gagcaaggag tagaaaggag gaaaataaag
      481 aaaagtgaga aagtgacacc caagacttca gttctgtcat tgaaaaggtg ttgaagcaac
      541 atgttgcaca cgatgcagct gctcctgctg gccactattg tgggcatggt caggagctcg
      601 ccgtacacga gctatcagaa ccaacggttc gccatggagc cgcaggatca gacggcagtg
      661 gttggggcca gggtaacgct accctgccga gtgatcaaca aacagggcac gctccaatgg
      721 accaaggatg actttggact tggcacgtcc cgggatctga gtggattcga acgctacgcg
      781 atggtgggca gtgacgagga gggtgactac tccctggaca tttatccagt gatgctggac
      841 gacgatgctc gttaccagtg ccaagtgagc ccaggtcccg agggccaacc agccattagg
      901 tccacattcg ccggattgac ggtgctcgtt ccgcccgagg cgcccaaaat cacacagggc
      961 gacgtcatct atgccaccga ggatcgcaaa gtggagatcg agtgcgtttc ggttggcgga
     1021 aagccggctg ctgagattac ctggattgat ggcctgggca atgtccttac ggataacatt
     1081 gagtacacgg tgataccgct gcccgatcag cgacgcttta cggccaagtc cgtcctgcga
     1141 ttgaccccca aaaaggaaca ccacaacacg aacttcagtt gccaggcgca gaacacggcg
     1201 gaccgcacct atcgctcggc gaaaatacgt gtcgaggtga aatatgcccc caaggtgaag
     1261 gtgaatgtga tgggctcgct tcccggcggt gcaggtggtt cggttggtgg tgcaggcggt
     1321 ggcagtgtcc acatgagcac cggttcccgt attgtggagc attcgcaggt gcgcttggag
     1381 tgccgggcag atgcgaatcc cagcgatgtc cggtaccgct ggttcataaa cgacgaaccg
     1441 atcatcggcg gccagaagac agagatggtg atacgcaatg tgactcgcaa gttccacgat
     1501 gcgattgtca agtgcgaggt gcagaattcc gtgggcaaga gtgaggacag cgaaaccctt
     1561 gacataagct atgctcccag tttccggcag cgaccacagt caatggaggc ggacgttggc
     1621 agcgtggtgt ccctaacctg cgaggtggac agcaatccgc agccggagat cgtctggata
     1681 cagcatccca gtgaccgggt ggtcggcacc agcacaaatc tcacattcag tgtgagcaat
     1741 gagacggctg gaaggtacta ctgcaaggcc aatgtacccg gatacgctga gatttcggca
     1801 gatgcctatg tctatctgaa gggctcgccg gcgattggat cgcagaggac acagtacgga
     1861 ctggtgggag atacggctcg gatcgaatgc tttgccagca gtgttcctcg agcccgtcac
     1921 gtctcgtgga cgttcaacgg ccaggagatc agctcggaat cgggacacga ctattcgatt
     1981 ctggttgatg ccgtgccggg gggcgtgaag agcacgctca tcattaggga cagccaggcc
     2041 taccactacg gaaagtacaa ctgcacggtg gtcaacgatt acggcaacga cgtggccgag
     2101 attcagctgc aagccaagaa gagcgtttcc ctgctgatga caattgtggg cggcatttcg
     2161 gtggtggcct tcctgctggt gctgaccatt ttggttgtgg tctacatcaa gtgtaagaag
     2221 cgcaccaagc tgccgccagc ggatgtgata agcgagcatc agatcacgaa aaatggcggc
     2281 gttagctgca aactggaacc aggcgaccgg acctcgaact acagcgatct aaaggtggac
     2341 atttcgggcg gctatgtgcc ctacggcgac tacagtacgc actacagtcc gcctccgcaa
     2401 tacctgacca cctgttcgac gaaatccaat ggcagctcga ccattatgca gaacaaccat
     2461 cagaaccaat tgcaactaca gcagcagcag caacagagcc accaccagca ccacacacag
     2521 acgacgaccc tgccgatgac cttcctgacc aacagcagcg gtggcagctt gactggcagt
     2581 attattggat cccgtgaaat tcgccaggac aacgggctgc ccagtctgca gtcgaccacc
     2641 gcctcggtgg ttagctcatc gccgaatggc agctgcagca atcagagcac cactgccgcc
     2701 accaccacca ccacccacgt ggtggtgccc agctcgatgg ccctgagtgt ggatccccgc
     2761 tatagcgcca tttacggcaa tccctatctt aggtcctcca actcgtcgct gctgccgcca
     2821 cccactgccg tttagggtgg accagcaccg tccaccacca acaccaccac caccaccact
     2881 gccaacaaca acgatgaccc actgagccac gctaagactg atctcacaag gaaccgaggc
     2941 cccggcggct gcttttgggg gggtatcact gttcgtggtg gtgcgttttt tcagctacca
     3001 aaaattcgaa ttgcttaggt ttaggcactt agctcacata catccgatta tataggcata
     3061 atcgtaagct gatctttagc atcatcattt ctatagtcct taggtctagg gtattttatt
     3121 ttatgttttt tttttttttt gtcgtttttg tgttcttagc ttaaggatct tacagtaggc
     3181 taatatcccc agtttgatct agagagagac taagcttcaa agaatgagtg ttaagcattt
     3241 acagaacaaa aaacaaatct taggaagatt agaaagtttt actgcttgtt gagaaaacgc
     3301 cgtaatgtac tagttaactg attggggatt taacctccag ttacaagaaa gaaaaaaact
     3361 ggttttcttg ggggcgggga tatgcgagag ccgttttgaa catgttctct gatttcatat
     3421 aatgtttcaa atattatttt cgattcaaat attatttccg tgtctcttat tctcaaaact
     3481 taatgctctt ctatttttaa aaaatttgat tgctattttt tgtacagtgt acatgtgtac
     3541 atgaaacttt agaactattt cgtaacgcgt aactctccca gagattttga aatcccaaga
     3601 atattccttc gtcaaaaaca gctgccccta tataatccgc aaaaaatata tagaatggta
     3661 attgaaagaa ttcaatttta tgtatacaca gctatagtat atgctaaatg ttaatgatat
     3721 atatatatac aacaagcatg aagacattca gttgaatgga tagcgagtaa gcgaacgaaa
     3781 tgccaaagta cctgatagta tttaagtagg gggtgggaaa gtctttggat cggtaccgcc
     3841 cgccattaac ttcttctgaa ttatgtagca ttatcttttc tcgccggaat tctaagctat
     3901 gacttgggat tcgatagtgt gttttacgat taaataaata tagaagctag atcttgacag
     3961 tcgccttaac ttatgacacg cccatacatc tcaaaacgcc catgcaaata taggaaaaga
     4021 aaacaaaaat gagagcgtaa acgtattcaa ttcgtcagtt caattgtgct aagtgtactt
     4081 ctaagtgtat aacggtctaa ttatcctagt tgtagcctaa ctaatgatag acacgcatat
     4141 ttaaagtata gaacctagcc ctagatatac atacatgcat tttttttcat aggcctaagc
     4201 attatatttt gataagccag cgtatttcgt ctaaggagcc cctgaaaagt aaacattact
     4261 atttcatttt gctatattta ttagctgtgg gtattttatt agtgtcgcca attaagcgcg
     4321 aaacgaacaa atgttttttg tttacaaaat gcaaatgata aaagcaaata agcagcatga
     4381 aacacacaca aagttaaaca cgaaaacaaa aagcaaaaaa aaaactgaat aaaaatttat
     4441 tgaaaaaaaa aaaaaaaaaa aacagaaagc cgaggaaagc gaattgagag ttggacatca
     4501 aagacgaaag acaaatatac ggtagggggc aaaaaacatt tttaatttgc ccaggtcgga
     4561 aggaccaact gtcagttagc tgcaaaaagc caaaaatcaa acaaacaaaa gtgaaatgaa
     4621 aatgttccac cactggcacc acttgcacca ccaccaccgc cagtcatgtg tgttaattta
     4681 tggcaagtcg actcgccgtt gtcggagcta ctgcactgtg gaaaaaggtg ggtatatttt
     4741 cgtatttaag aatgatttgg ctttcgagga taagcaagtg gtaaaataaa agaggttaaa
     4801 ataagagaaa aaacgtcttt aactcttttc tgtatactag atttgaattc tattatgttt
     4861 ttttgctatt gatttatttt aatttaattt taatttattc cagaaaacgc tttctaccat
     4921 attttcactc agtgtgactg accagagttg tgaagttgac aatgcaaaca aacggctcgc
     4981 taagctcgac taaaaatgct taatgagagt gcgtaagggt ggccccccaa ccgttgaacc
     5041 acccaccagt tcaccactcc acccgcttcc ccctttccca ccccagccca ccagtttcag
     5101 gacccttttt cgccgcccct tgaggcaagt gttggccgca agaaattctg cggctatggg
     5161 caacaaagtc gcgcacgacg cccattaaac taaattagtt gccctttgtc accgaacgac
     5221 cctcgctgtc acacgtggct cgctgggggc ggtggggtcg aatgttttgg ggcggcgggt
     5281 ggttcgaaca tacgtgcact tagccagaag gaagttgcaa ttgcggttgg ctgtgttaat
     5341 tagcgttttc tttttttcct cattgcgaaa gcgaagggga aactctcgaa aactgaaact
     5401 aacgtgagtt ggcaaatgtc aagagactgg tgaaagtaaa gccacagaaa ctgacattag
     5461 ttggaatcct tttcagaacc ctttatgaaa gtgcaccagc ttcacttcag tttctttaat
     5521 gctaatgcta ctctactaag gcaatattca atgcaaagcc ttgtacacat tgatattcac
     5581 tttgatatac ttgcatagga atattcaata tatttttcct cacatatgta tgcttatagt
     5641 atttttttta tttattttgg aaaattgctt ggcgtttccc aagcccccaa cctcgttgac
     5701 aattggcaaa agttgcgagt aagcttcttc agaaacagca attcgcattg tccgtgaagt
     5761 cgtgcggagt tttgccggcg cgttaatcac tctgcaatcc aacatccttt cgggtttcag
     5821 gttccctcgg ctcctctttg ggatgacttt ttttttcaag gggaggacgg aggacgggac
     5881 tggagatggc gcaaaaaacg gacacgaggc gcccgaagag ttacgatttc attaacatga
     5941 gatatggcaa ctgccaaagc gctggtcgct ccgaagcctt gggttttctt tttttttttt
     6001 tgggtacagg attgggggtt tgtggttcgg ttcggttcgg ttcggttcgg ttcggggtcg
     6061 gttcggttcg gggtcgttcc gggggtcgtg ttgggctggt ttatggctca agtgttggct
     6121 tgtcgtcgcc gcttgtgtcg cactgcgttg ttaattgcta caaggagagt ggtcgaagga
     6181 gcgacagaga caggtggatg gaaagcactc ggaaaaatca ttgacccact tggaaacatg
     6241 ggatctcacg t