Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001297806 1675 bp mRNA linear INV 26-DEC-2023 C (CG13375), mRNA. ACCESSION NM_001297806 VERSION NM_001297806.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1675) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1675) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1675) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1675) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1675) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1675) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1675) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1675) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1675) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1675) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1675) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1675) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1675) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1675) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1675) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1675) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1675) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1675) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1675 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1675 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /map="1A1-1A1" /db_xref="FLYBASE:FBgn0040370" /db_xref="GeneID:30976" CDS 666..1499 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="CG13375 gene product from transcript CG13375-RC; CG13375-PC" /codon_start=1 /product="uncharacterized protein, isoform C" /protein_id="NP_001284735.1" /db_xref="FLYBASE:FBpp0309734" /db_xref="GeneID:30976" /db_xref="FLYBASE:FBgn0040370" /translation="MVGRNNAVDDAIGPANARHKIVVMGSAKVGKTSIITQFLYNTFS TKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDA TTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYATTESVVTVDWEN GFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQSLPQQIGNNGPSTPLHHHQ HTQHHNSGGGTSASTSSAAAAASSSGGSGSHAPTPAQLQHLQRIQERSLGAKRNSCII S" misc_feature 723..1295 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="Ras - dorsal-ventral anterior localization (Ras-dva) family; Region: Ras_dva; cd04147" /db_xref="CDD:206714" misc_feature 738..761 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="G1 box; other site" /db_xref="CDD:206714" misc_feature order(741..746,885..890) /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206714" misc_feature order(744..764,879..881,888..890,1056..1061,1065..1067, 1161..1166) /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206714" misc_feature order(759..764,801..803,807..809,828..833,870..875, 879..881,885..890,1167..1169) /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206714" misc_feature order(804..809,822..833) /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="putative effector interaction site [active]" /db_xref="CDD:206714" misc_feature 804..830 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="Switch I region; other site" /db_xref="CDD:206714" misc_feature 810..812 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="G2 box; other site" /db_xref="CDD:206714" misc_feature 879..890 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="G3 box; other site" /db_xref="CDD:206714" misc_feature order(885..926,936..941) /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="Switch II region; other site" /db_xref="CDD:206714" misc_feature 1056..1067 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="G4 box; other site" /db_xref="CDD:206714" misc_feature 1161..1169 /gene="CG13375" /locus_tag="Dmel_CG13375" /gene_synonym="Dmel\CG13375; EG:BACR37P7.8" /note="G5 box; other site" /db_xref="CDD:206714" ORIGIN 1 acgcagcgtg ttgttatatc gcatctgccc caaaacaatt ttcatctcaa cagctacaaa 61 aacagaacac tcttagcaag aaatcaaata ccaccctaga taaaaaataa acggaaaatt 121 tgttatttct ttcgtacatg gtaaagaatc tttttttact tgtgtttctg tgatttgagt 181 gtttgaaaaa tttaacatac caatagtaat tatattaaaa gtttcgaagt gaaagcccct 241 ccgagaacag gtgaacacag gaatacaacg cgaagattag catttttaat attctggtgg 301 aaagacgaac cgcaaaggga aaaacgctaa agaataagca aagtacgatg gactaacagt 361 ttgccagtga gcgctacatt ttcagctaag ctgcaaatat aaaacggcat acgaagcatg 421 agcattaaat cttaggcgag ggtcgttgac ttatcagtag cctcaataat cagggagacc 481 actcaggtat tccaaggatt acaatatgcg tggccgccac ttacgccgcc gattcagcct 541 gcagccctcg tttatgaagg acgacaatgc cgaggataag ccaaagcgtg ataataccaa 601 ggcagcattc ttatttgact gggttcaaaa gacgacataa aagggaaaga aaaacgcagt 661 caccaatggt tggtagaaac aacgcggtag atgatgccat tggaccggcc aacgcacgcc 721 acaaaatcgt cgtcatgggc tctgcaaaag tgggaaaaac gtcaataatc acccagtttc 781 tgtacaatac atttagcacc aagtacaagc ggaccattga ggaaatgcac caaggcaact 841 tttccatcgc cggcgtgagc cttacccttg atattttgga cactgccggc tcatacgagt 901 ttccggcgat gcgagctctt tccatatcct cggcggatgc ttttattctg gtctacgacg 961 taaccgatgc caccactttc gaggaggtgc gcacaattcg cgatcagatc cacgagacta 1021 aggccactac cgctgttcca attgtagttg tcgggaacaa gatcgatctc ttagcagatg 1081 gagaaactga gcgagaggtt gagtacgcca ccacagaatc ggttgttact gtggactggg 1141 agaacggatt tgtagaggct tcagcttcca gtaatgaaaa cattacccag gtgttcaagg 1201 aactgctagc ccaggcaaaa ataacttaca atctgagtcc ggccctccgt cgtcgtcgac 1261 agtcgttgcc gcagcagatt ggtaacaatg gacccagcac cccgttacac caccaccagc 1321 acacccagca ccacaattcc ggaggtggta cctccgcttc tacctcttcg gcagctgcag 1381 ctgcgtcatc ttccggggga tccggatccc atgctcctac acctgcccag ctgcagcacc 1441 tccaaagaat ccaggagcga agcttgggcg ccaaacgcaa ctcgtgcatc atttcctaaa 1501 caggccaaac tgaaagaggt ctaatatata atggttttca aaaccttttc aatagtctat 1561 aataacatgg ggcgtttttc taaactcaaa caacagaact aatattaaca gaagaggcag 1621 attaattcta ttaacatgag agtcttgtaa gggaagacaa cattctgggt gagct