Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster protein tyrosine phosphatase 10D,


LOCUS       NM_001272525            7142 bp    mRNA    linear   INV 26-DEC-2023
            transcript variant I (Ptp10D), mRNA.
ACCESSION   NM_001272525
VERSION     NM_001272525.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 7142)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7142)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 7142)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 7142)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 7142)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 7142)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 7142)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 7142)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 7142)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 7142)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 7142)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 7142)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 7142)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 7142)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 7142)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 7142)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 7142)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 7142)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..7142
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..7142
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Protein tyrosine phosphatase 10D"
                     /map="10D1-10D4"
                     /db_xref="FLYBASE:FBgn0004370"
                     /db_xref="GeneID:32115"
     CDS             490..5166
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /EC_number="3.1.3.-"
                     /EC_number="3.1.3.48"
                     /note="CG1817 gene product from transcript CG1817-RI;
                     CG1817-PI; Ptp10D-PI; protein tyrosine phosphatase 10B"
                     /codon_start=1
                     /product="protein tyrosine phosphatase 10D, isoform I"
                     /protein_id="NP_001259454.1"
                     /db_xref="FLYBASE:FBpp0303823"
                     /db_xref="GeneID:32115"
                     /db_xref="FLYBASE:FBgn0004370"
                     /translation="MLYQLSKATTRIRLKRQKAVPQHRWLWSLAFLAAFTLKDVRCAD
                     LAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWL
                     YYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLG
                     LSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPN
                     TPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ
                     AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLW
                     EAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGKV
                     TSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIVYHELETFNGD
                     TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPSSPIIEDLKSIR
                     MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVIKNLQPGAGYELKVFAV
                     SHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQ
                     QWVRLPSVRSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQL
                     VDSRNITLEWPKPEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELM
                     PGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ
                     SSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLPI
                     QRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNE
                     ITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPS
                     EINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVF
                     KIQAKTAIGFGPEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNG
                     QVRMYTIIVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGT
                     ENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITV
                     PLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYR
                     LMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDD
                     DEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGR
                     EKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPD
                     FGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYV
                     DIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKENIVGPAREMHDNEGYEDDEG
                     IAESGM"
     misc_feature    <631..1719
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(856..858,1051..1053,1096..1098)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    859..1104
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1099..1104,1108..1113)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(1138..1140,1339..1341,1384..1386)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    1147..1401
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1387..1392,1396..1401)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    1702..1971
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(1702..1704,1891..1893,1936..1938)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(1939..1944,1948..1953)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2020..2211
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    <2143..>2601
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2506..2508,2710..2712,2755..2757)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    2536..2742
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    2848..3039
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cl21522"
                     /db_xref="CDD:473895"
     misc_feature    order(3043..3048,3052..3057)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3079..3081,3253..3255,3298..3300)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3085..3294
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(3361..3363,3559..3561,3604..3606)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3364..3618
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3736..4050
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="TM proximal of protein tyrosine phosphatase,
                     receptor type J; Region: PTP_tm; pfam18861"
                     /db_xref="CDD:465889"
     misc_feature    4390..5055
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="catalytic domain of R3 subfamily receptor-type
                     tyrosine-protein phosphatases and similar proteins;
                     Region: R3-PTPc; cd14548"
                     /db_xref="CDD:350396"
ORIGIN      
        1 atcagattcc aattcagtgt ggtgaagagc gaaccggagt gcggacggta cggacgcgaa
       61 atctgttaag gcgggccgca aagcaaacgc tcgaaaaacg caaaatttgt cgattgtccg
      121 ttccgctttt ttcttgtgtc tgtgctttgc gtcgcgtgcc tgcgtgtacg ttggcgtgcc
      181 gaatgagcaa aatttgagaa aaacgcagtg gaaaaccaat tggattcagg ataaaaattt
      241 acaaaatttc accacactaa cgggaaaact gtgaaaacaa tgcatttaat caaagtaaag
      301 actaaactcg cgctaaaaat gcccgaattc gaaagaaact agcgaaaagc ccaattcaaa
      361 aatcgcacaa taaattgcaa agtccaaagc aacaacaaca taggaacaaa taaaacaaga
      421 agcaggcaac aaaagagagc caggcggaga ggaaaacaac aacgaaaaca gcaaaacgac
      481 ggccccaaaa tgttgtacca gctaagtaaa gccactacta gaatccggct caaaaggcaa
      541 aaagccgttc cacaacatcg ctggctctgg agtttagcat ttctggcagc atttacacta
      601 aaggacgttc gatgtgcaga tctagccata agtataccca ataatcccgg cctggacgat
      661 ggggcctcct atcgactgga ctatagtccg cccttcggtt atccggagcc caacacgacg
      721 attgcctcgc gggaaatcgg cgatgagatt caattctcac gcgccctacc gggcaccaaa
      781 tacaactttt ggctgtacta cacgaacttt acgcaccacg attggctcac ctggacggtg
      841 acgataacaa cggctcccga tccgccgtcg aatctgtccg ttcaggtgag aagcggcaag
      901 aatgccatca tcctatggtc accgcccacc cagggcagct atacggcgtt taagatcaag
      961 gtgctcggac tgtcggaggc gtcgagcagc tacaaccgca cctttcaggt gaacgacaat
     1021 acattccagc acagcgtcaa ggagctgaca cccggagcca cctaccaggt gcaggcatat
     1081 accatctacg atggcaagga gtcggtggcc tacactagtc gcaacttcac cacaaagccc
     1141 aacactccgg ggaaattcat cgtctggttc cgtaatgaga cgacactgct ggtcctgtgg
     1201 cagccgccat atccggcggg catctacacg cactacaagg tatccatcga gccgccggat
     1261 gccaacgata gtgtgctcta tgtggaaaag gagggcgaac cgcccggacc ggcgcaggct
     1321 gccttcaagg gtctggtgcc cggaagggcg tacaacatat ccgttcagac gatgtccgag
     1381 gatgagatct cattgccgac gacggcgcaa tatcgaacgg tgccgttgcg tccgctgaac
     1441 gtgacctttg accgtgactt tattacctcc aattcgttcc gtgtcctgtg ggaggcgccc
     1501 aaggggatat ccgaatttga caaataccag gtatcggtgg ccacaacacg acgccaatcc
     1561 acagtgccgc gcagcaatga accggtggca ttctttgatt ttcgcgacat cgccgaaccg
     1621 ggcaagacgt tcaatgtgat cgtgaagacc gtatccggca aggttacctc gtggccagcc
     1681 accggggatg tgacactgcg accactgccc gttcgcaatt tgcggagcat caacgatgac
     1741 aagacgaata ctatgatcat aacgtgggaa gcggatccgg ccagcacgca ggatgagtat
     1801 cgcattgtat accacgaact ggagacattt aatggtgaca ccagtaccct gaccacggat
     1861 cggactcgat tcacactgga gagcctgcta cccggtcgca actactcatt gtccgtccag
     1921 gcggtatcca agaagatgga atcgaatgag actagcatct ttgtggtcac ccgaccctcg
     1981 tcgcccatca tcgaggactt gaagagcata cggatgggtc tgaacatcag ttggaagagc
     2041 gatgtcaact ccaagcagga gcagtacgag gtgttgtact cgcgcaacgg aaccagcgat
     2101 ttgcgaaccc aaaagaccaa agagtcgcgt ctggtgatca agaatctgca gccaggtgct
     2161 ggctatgaac tcaaggtgtt tgcagttagt cacgatttgc gcagcgaacc acatgcctat
     2221 ttccaagcag tttatcccaa tccaccacgc aacatgacca tcgaaacggt gaggagtaac
     2281 tcggtgctgg tacactggtc accgccggaa agcggtgaat ttaccgagta ctcgatacgc
     2341 tatcgcacgg acagcgaaca gcagtgggtg cgattgccca gcgttcggtc cacggaggcg
     2401 gatatcaccg atatgaccaa gggcgaaaag tacaccatcc aggtgaacac ggtcagcttt
     2461 ggcgtagaga gtccagtgcc ccaggaggtg aacacgacgg tgccgccgaa tccggtgtcc
     2521 aatatcattc aactggtgga ctcacggaac attacgttgg agtggcccaa gccagagggt
     2581 cgcgtggaat cgtacattct taagtggtgg cccagcgata atcccggtcg tgtccagacc
     2641 aagaatgtct ccgagaacaa gtcggccgac gatttgtcaa cagtgcgtgt cctcatcggc
     2701 gaactgatgc ccggcgtgca gtacaagttt gacatccaga cgacgtcgta tggaatcctg
     2761 tcgggcatca ccagtctgta tccgcgcacc atgccgctca tccagtcgga cgtggtggtg
     2821 gccaatggcg agaaggagga cgagagggac accatcactc tgagctacac acccacaccg
     2881 cagtcgtcgt ccaagttcga tatctatcga ttctctctcg gcgatgccga gatccgggac
     2941 aaggagaagc tggccaacga tacggatcgc aaggtgacgt ttacgggtct ggtgcctggt
     3001 cgattgtaca acatcacagt ttggactgtg agcggtggtg tggccagttt gcccatacaa
     3061 cgacaggatc gcctgtatcc ggaacccatc acacagctgc atgccaccaa catcacggat
     3121 acggagatct cattgcgctg ggatttgccc aagggcgagt acaatgactt cgatattgcc
     3181 tatctcacgg cggacaatct attggcccag aatatgacca ccaggaatga gatcaccatc
     3241 agtgacctgc gaccccacag gaactacacc ttcaccgtgg tggtacgttc cggcactgaa
     3301 tcgtccgtgc tgaggagcag ttcaccatta tccgctagct ttacgaccaa tgaagcggtg
     3361 cccgggcgag ttgaacgctt ccatcccacg gatgttcagc ccagcgagat caatttcgag
     3421 tggtcgctgc catcgagtga ggcaaatggc gttattcgcc agttctcgat agcctatacg
     3481 aatatcaata atctcacgga cgcaggcatg caggactttg agtcggagga ggcattcggt
     3541 gtgatcaaga atctaaagcc cggcgagacc tatgtgttca agattcaggc caagactgcc
     3601 atcggtttcg gtccggagcg ggagtaccgt caaacgatgc cgatattagc gccaccacgt
     3661 cctgccaccc aagtggtgcc caccgaggtc tatcgcagct catcgaccat ccagattcgg
     3721 tttaggaaga actacttctc ggatcaaaac ggccaggtgc gcatgtacac gatcatcgtg
     3781 gccgaggatg atgccaagaa tgcatccggc ctggagatgc ccagctggct ggatgtgcag
     3841 tcgtacagcg tttggttgcc ctatcaggcc atagatccgt actatccatt cgagaatcga
     3901 tccgtagagg acttcaccat cggtacggag aactgtgaca accacaagat cggctactgc
     3961 aacggaccac tgaaatcggg aaccacctat cgggttaagg tgcgggcgtt caccggagcg
     4021 gataagttca cggataccgc ctacagtttt cccattcaga cagatcaaga caacacctca
     4081 ctgattgtgg ccattacggt gccgttaact atcatcttgg tgctcctggt gacacttttg
     4141 ttctacaaac gacgtcgcaa caattgccgt aagacgacca aggattcgag ggccaacgac
     4201 aatatgtccc tgccggatag cgtaatcgag cagaatcgcc ccattctgat caagaacttt
     4261 gccgagcact atcgcctaat gtccgccgat tcggacttcc gtttcagcga ggaattcgag
     4321 gaactgaagc acgttggccg ggatcagccg tgcacttttg ccgatctacc ctgcaatcgt
     4381 ccgaaaaaca ggttcaccaa tatactgccc tacgatcact cacgtttcaa gcttcagccg
     4441 gtggacgatg atgagggtag tgattatatc aatgccaatt acgtgccggg tcacaattca
     4501 ccgcgcgagt tcatcgtgac ccagggacca ttgcattcga cacgcgatga cttctggcga
     4561 atgtgctggg agagcaactc gcgggccata gtcatgctga ccaggtgctt tgagaagggg
     4621 cgcgagaagt gcgaccagta ttggccaaat gatacggtgc ccgtcttcta cggtgacatc
     4681 aaggtgcaga tactcaacga cagtcactat gccgactggg tgatgaccga gttcatgcta
     4741 tgcagaggca gcgaacagcg catcctgcga cacttccact tcaccacctg gccggacttc
     4801 ggtgttccca atccgccaca gacactggtg cgctttgtgc gcgcattccg cgatcgaatt
     4861 ggtgcggaac agcgacccat tgtggtccat tgtagcgccg gtgtgggaag gtcgggcacc
     4921 ttcatcaccc tggatcgcat cctgcaacag atcaacacgt ctgactatgt ggacatattt
     4981 ggcatagtat atgccatgcg caaggagcgc gtttggatgg tgcagacgga gcagcagtat
     5041 atctgcatcc accagtgcct gctggcggtg ctcgagggga aggagaacat cgtgggtccc
     5101 gctcgcgaga tgcacgacaa cgagggctat gaagatgacg agggcattgc agagtcgggc
     5161 atgtaaagcc attccaaaac ccaatactcc agccaatcca agccagccag ccagccaacc
     5221 aagcaactga actcaactca accgaatgga aacccaaccc aacccaacag aacccaacca
     5281 tcttgtggca actacattat tatttactta agggacgaag tgcgaagaga gcgcggagga
     5341 ggatcaacgc ttgatattat acttggatat atgtgtacta cactggatac tactggatat
     5401 atatatatat atatactcta caccgcgatc tatcgaatgg gaatgcagca atctcgccaa
     5461 acagaacgaa cacgcatcaa tttatacatt ttatatatat ataaagatat atatatctaa
     5521 gataacgagg aatcggcgta caatgtaacc gcaattgccg cttcaaaccg acggcaatac
     5581 taaatactgg aatactgatt gtatttttac gctagccaca atttgatata aactatatat
     5641 cttccaattt ttttgtacac ctaatgttag ttgaaatatg tgagcgagac gagcaaattt
     5701 ttgtagcaaa ctaaaagcgc taaatgttta cttttttata ttattatata tataaatact
     5761 tgataaacat atacctaata ttagatctaa actaaactaa ctataaatcg cacacactca
     5821 tacactcaca caaaaacaca atgcaataat tgagttacat agttttaaac aaatgttaaa
     5881 acattttgct gcaaccgtcg gagatgtagt gtacaatttt tagtttctcg tattattttt
     5941 ttttttatgt ctgttttgtg tttaaatttt ttgtaacttt ttacaaagcg taaactgtgt
     6001 atgtatgtgc tacattgatt tttgtttaat tatatcaagt ttttatttaa aaaatcgaac
     6061 accaccttgc attctcctca tttgaacgtg gcgctcacac ttattactta tataggtcaa
     6121 atacagcggg ctctggtgat caatccaatc agcagaaagt aatgaaaaac accgaagtta
     6181 atgtttaaac ataaacacac aatgagaaaa gagtcgtgtt tccatattca cttgatttaa
     6241 tcggcatgcg atgttactca cagcgaaagg aaattcagca agcttgaatc gataaaattg
     6301 ttgtatatat taaatagttt aacactgtgt aattttattt atcctagctc gattctaagt
     6361 gcttgcgtaa atgatcattt aaattttcta acccgaaaga acttatttat tggtttattt
     6421 atacaaaatt gaaatgaagt gcatatggaa acacaactca aaaacagaca gcacaaatag
     6481 aacaacagga acaaatgacc aacgcatttc gaaaggcgat aatcatttac acgaaaaacc
     6541 aatataatta aacagaatcc cacgcaaact gaagactaac taacaaccaa gttaagggct
     6601 agttaatgga gccggtgcca aagcaaaaaa ggaaaaatga taacaacacc tacacacacg
     6661 acaactaaat gtaacaatag caatacattt taatgaaaat tgtagtccaa ataatttgca
     6721 tacatttgta ttttgtccaa acttagttga aatgattaac cgaactgtga aagagtgcaa
     6781 tagaaatcgt tttgcttcta gattagtgaa aaatacaacg aagcccctaa tttgaatacg
     6841 aagcaaccca aaatccccgc cctcccgtaa taacaataaa tacatatgca taattatgca
     6901 aaagtttgag aagatgaaac tagaaagtct gtataatgca tacataatat acgactccat
     6961 tatacacaca cacacgcata ctaaggccga tgaataacat atgcatatac aatatagaca
     7021 tatattaaat atatatcatt gtaataattt gtaatgttta tcagtagaat tatgatccga
     7081 ggtggagcag acgagtaaaa cgcatgcaga gatccattaa agtgtactgt aaaatgtgcc
     7141 ac