Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001272525 7142 bp mRNA linear INV 26-DEC-2023 transcript variant I (Ptp10D), mRNA. ACCESSION NM_001272525 VERSION NM_001272525.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 7142) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 7142) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 7142) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 7142) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 7142) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 7142) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 7142) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 7142) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 7142) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 7142) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 7142) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 7142) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 7142) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 7142) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 7142) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 7142) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 7142) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 7142) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..7142 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..7142 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Protein tyrosine phosphatase 10D" /map="10D1-10D4" /db_xref="FLYBASE:FBgn0004370" /db_xref="GeneID:32115" CDS 490..5166 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /EC_number="3.1.3.-" /EC_number="3.1.3.48" /note="CG1817 gene product from transcript CG1817-RI; CG1817-PI; Ptp10D-PI; protein tyrosine phosphatase 10B" /codon_start=1 /product="protein tyrosine phosphatase 10D, isoform I" /protein_id="NP_001259454.1" /db_xref="FLYBASE:FBpp0303823" /db_xref="GeneID:32115" /db_xref="FLYBASE:FBgn0004370" /translation="MLYQLSKATTRIRLKRQKAVPQHRWLWSLAFLAAFTLKDVRCAD LAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWL YYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLG LSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPN TPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLW EAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGKV TSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIVYHELETFNGD TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPSSPIIEDLKSIR MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVIKNLQPGAGYELKVFAV SHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQ QWVRLPSVRSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQL VDSRNITLEWPKPEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELM PGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ SSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLPI QRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNE ITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPS EINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVF KIQAKTAIGFGPEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNG QVRMYTIIVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGT ENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITV PLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYR LMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDD DEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGR EKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPD FGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYV DIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKENIVGPAREMHDNEGYEDDEG IAESGM" misc_feature <631..1719 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(856..858,1051..1053,1096..1098) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 859..1104 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(1099..1104,1108..1113) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(1138..1140,1339..1341,1384..1386) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 1147..1401 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(1387..1392,1396..1401) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 1702..1971 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(1702..1704,1891..1893,1936..1938) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(1939..1944,1948..1953) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2020..2211 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature <2143..>2601 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2506..2508,2710..2712,2755..2757) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 2536..2742 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 2848..3039 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cl21522" /db_xref="CDD:473895" misc_feature order(3043..3048,3052..3057) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3079..3081,3253..3255,3298..3300) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3085..3294 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(3361..3363,3559..3561,3604..3606) /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3364..3618 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3736..4050 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="TM proximal of protein tyrosine phosphatase, receptor type J; Region: PTP_tm; pfam18861" /db_xref="CDD:465889" misc_feature 4390..5055 /gene="Ptp10D" /locus_tag="Dmel_CG1817" /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp; DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d; ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d" /note="catalytic domain of R3 subfamily receptor-type tyrosine-protein phosphatases and similar proteins; Region: R3-PTPc; cd14548" /db_xref="CDD:350396" ORIGIN 1 atcagattcc aattcagtgt ggtgaagagc gaaccggagt gcggacggta cggacgcgaa 61 atctgttaag gcgggccgca aagcaaacgc tcgaaaaacg caaaatttgt cgattgtccg 121 ttccgctttt ttcttgtgtc tgtgctttgc gtcgcgtgcc tgcgtgtacg ttggcgtgcc 181 gaatgagcaa aatttgagaa aaacgcagtg gaaaaccaat tggattcagg ataaaaattt 241 acaaaatttc accacactaa cgggaaaact gtgaaaacaa tgcatttaat caaagtaaag 301 actaaactcg cgctaaaaat gcccgaattc gaaagaaact agcgaaaagc ccaattcaaa 361 aatcgcacaa taaattgcaa agtccaaagc aacaacaaca taggaacaaa taaaacaaga 421 agcaggcaac aaaagagagc caggcggaga ggaaaacaac aacgaaaaca gcaaaacgac 481 ggccccaaaa tgttgtacca gctaagtaaa gccactacta gaatccggct caaaaggcaa 541 aaagccgttc cacaacatcg ctggctctgg agtttagcat ttctggcagc atttacacta 601 aaggacgttc gatgtgcaga tctagccata agtataccca ataatcccgg cctggacgat 661 ggggcctcct atcgactgga ctatagtccg cccttcggtt atccggagcc caacacgacg 721 attgcctcgc gggaaatcgg cgatgagatt caattctcac gcgccctacc gggcaccaaa 781 tacaactttt ggctgtacta cacgaacttt acgcaccacg attggctcac ctggacggtg 841 acgataacaa cggctcccga tccgccgtcg aatctgtccg ttcaggtgag aagcggcaag 901 aatgccatca tcctatggtc accgcccacc cagggcagct atacggcgtt taagatcaag 961 gtgctcggac tgtcggaggc gtcgagcagc tacaaccgca cctttcaggt gaacgacaat 1021 acattccagc acagcgtcaa ggagctgaca cccggagcca cctaccaggt gcaggcatat 1081 accatctacg atggcaagga gtcggtggcc tacactagtc gcaacttcac cacaaagccc 1141 aacactccgg ggaaattcat cgtctggttc cgtaatgaga cgacactgct ggtcctgtgg 1201 cagccgccat atccggcggg catctacacg cactacaagg tatccatcga gccgccggat 1261 gccaacgata gtgtgctcta tgtggaaaag gagggcgaac cgcccggacc ggcgcaggct 1321 gccttcaagg gtctggtgcc cggaagggcg tacaacatat ccgttcagac gatgtccgag 1381 gatgagatct cattgccgac gacggcgcaa tatcgaacgg tgccgttgcg tccgctgaac 1441 gtgacctttg accgtgactt tattacctcc aattcgttcc gtgtcctgtg ggaggcgccc 1501 aaggggatat ccgaatttga caaataccag gtatcggtgg ccacaacacg acgccaatcc 1561 acagtgccgc gcagcaatga accggtggca ttctttgatt ttcgcgacat cgccgaaccg 1621 ggcaagacgt tcaatgtgat cgtgaagacc gtatccggca aggttacctc gtggccagcc 1681 accggggatg tgacactgcg accactgccc gttcgcaatt tgcggagcat caacgatgac 1741 aagacgaata ctatgatcat aacgtgggaa gcggatccgg ccagcacgca ggatgagtat 1801 cgcattgtat accacgaact ggagacattt aatggtgaca ccagtaccct gaccacggat 1861 cggactcgat tcacactgga gagcctgcta cccggtcgca actactcatt gtccgtccag 1921 gcggtatcca agaagatgga atcgaatgag actagcatct ttgtggtcac ccgaccctcg 1981 tcgcccatca tcgaggactt gaagagcata cggatgggtc tgaacatcag ttggaagagc 2041 gatgtcaact ccaagcagga gcagtacgag gtgttgtact cgcgcaacgg aaccagcgat 2101 ttgcgaaccc aaaagaccaa agagtcgcgt ctggtgatca agaatctgca gccaggtgct 2161 ggctatgaac tcaaggtgtt tgcagttagt cacgatttgc gcagcgaacc acatgcctat 2221 ttccaagcag tttatcccaa tccaccacgc aacatgacca tcgaaacggt gaggagtaac 2281 tcggtgctgg tacactggtc accgccggaa agcggtgaat ttaccgagta ctcgatacgc 2341 tatcgcacgg acagcgaaca gcagtgggtg cgattgccca gcgttcggtc cacggaggcg 2401 gatatcaccg atatgaccaa gggcgaaaag tacaccatcc aggtgaacac ggtcagcttt 2461 ggcgtagaga gtccagtgcc ccaggaggtg aacacgacgg tgccgccgaa tccggtgtcc 2521 aatatcattc aactggtgga ctcacggaac attacgttgg agtggcccaa gccagagggt 2581 cgcgtggaat cgtacattct taagtggtgg cccagcgata atcccggtcg tgtccagacc 2641 aagaatgtct ccgagaacaa gtcggccgac gatttgtcaa cagtgcgtgt cctcatcggc 2701 gaactgatgc ccggcgtgca gtacaagttt gacatccaga cgacgtcgta tggaatcctg 2761 tcgggcatca ccagtctgta tccgcgcacc atgccgctca tccagtcgga cgtggtggtg 2821 gccaatggcg agaaggagga cgagagggac accatcactc tgagctacac acccacaccg 2881 cagtcgtcgt ccaagttcga tatctatcga ttctctctcg gcgatgccga gatccgggac 2941 aaggagaagc tggccaacga tacggatcgc aaggtgacgt ttacgggtct ggtgcctggt 3001 cgattgtaca acatcacagt ttggactgtg agcggtggtg tggccagttt gcccatacaa 3061 cgacaggatc gcctgtatcc ggaacccatc acacagctgc atgccaccaa catcacggat 3121 acggagatct cattgcgctg ggatttgccc aagggcgagt acaatgactt cgatattgcc 3181 tatctcacgg cggacaatct attggcccag aatatgacca ccaggaatga gatcaccatc 3241 agtgacctgc gaccccacag gaactacacc ttcaccgtgg tggtacgttc cggcactgaa 3301 tcgtccgtgc tgaggagcag ttcaccatta tccgctagct ttacgaccaa tgaagcggtg 3361 cccgggcgag ttgaacgctt ccatcccacg gatgttcagc ccagcgagat caatttcgag 3421 tggtcgctgc catcgagtga ggcaaatggc gttattcgcc agttctcgat agcctatacg 3481 aatatcaata atctcacgga cgcaggcatg caggactttg agtcggagga ggcattcggt 3541 gtgatcaaga atctaaagcc cggcgagacc tatgtgttca agattcaggc caagactgcc 3601 atcggtttcg gtccggagcg ggagtaccgt caaacgatgc cgatattagc gccaccacgt 3661 cctgccaccc aagtggtgcc caccgaggtc tatcgcagct catcgaccat ccagattcgg 3721 tttaggaaga actacttctc ggatcaaaac ggccaggtgc gcatgtacac gatcatcgtg 3781 gccgaggatg atgccaagaa tgcatccggc ctggagatgc ccagctggct ggatgtgcag 3841 tcgtacagcg tttggttgcc ctatcaggcc atagatccgt actatccatt cgagaatcga 3901 tccgtagagg acttcaccat cggtacggag aactgtgaca accacaagat cggctactgc 3961 aacggaccac tgaaatcggg aaccacctat cgggttaagg tgcgggcgtt caccggagcg 4021 gataagttca cggataccgc ctacagtttt cccattcaga cagatcaaga caacacctca 4081 ctgattgtgg ccattacggt gccgttaact atcatcttgg tgctcctggt gacacttttg 4141 ttctacaaac gacgtcgcaa caattgccgt aagacgacca aggattcgag ggccaacgac 4201 aatatgtccc tgccggatag cgtaatcgag cagaatcgcc ccattctgat caagaacttt 4261 gccgagcact atcgcctaat gtccgccgat tcggacttcc gtttcagcga ggaattcgag 4321 gaactgaagc acgttggccg ggatcagccg tgcacttttg ccgatctacc ctgcaatcgt 4381 ccgaaaaaca ggttcaccaa tatactgccc tacgatcact cacgtttcaa gcttcagccg 4441 gtggacgatg atgagggtag tgattatatc aatgccaatt acgtgccggg tcacaattca 4501 ccgcgcgagt tcatcgtgac ccagggacca ttgcattcga cacgcgatga cttctggcga 4561 atgtgctggg agagcaactc gcgggccata gtcatgctga ccaggtgctt tgagaagggg 4621 cgcgagaagt gcgaccagta ttggccaaat gatacggtgc ccgtcttcta cggtgacatc 4681 aaggtgcaga tactcaacga cagtcactat gccgactggg tgatgaccga gttcatgcta 4741 tgcagaggca gcgaacagcg catcctgcga cacttccact tcaccacctg gccggacttc 4801 ggtgttccca atccgccaca gacactggtg cgctttgtgc gcgcattccg cgatcgaatt 4861 ggtgcggaac agcgacccat tgtggtccat tgtagcgccg gtgtgggaag gtcgggcacc 4921 ttcatcaccc tggatcgcat cctgcaacag atcaacacgt ctgactatgt ggacatattt 4981 ggcatagtat atgccatgcg caaggagcgc gtttggatgg tgcagacgga gcagcagtat 5041 atctgcatcc accagtgcct gctggcggtg ctcgagggga aggagaacat cgtgggtccc 5101 gctcgcgaga tgcacgacaa cgagggctat gaagatgacg agggcattgc agagtcgggc 5161 atgtaaagcc attccaaaac ccaatactcc agccaatcca agccagccag ccagccaacc 5221 aagcaactga actcaactca accgaatgga aacccaaccc aacccaacag aacccaacca 5281 tcttgtggca actacattat tatttactta agggacgaag tgcgaagaga gcgcggagga 5341 ggatcaacgc ttgatattat acttggatat atgtgtacta cactggatac tactggatat 5401 atatatatat atatactcta caccgcgatc tatcgaatgg gaatgcagca atctcgccaa 5461 acagaacgaa cacgcatcaa tttatacatt ttatatatat ataaagatat atatatctaa 5521 gataacgagg aatcggcgta caatgtaacc gcaattgccg cttcaaaccg acggcaatac 5581 taaatactgg aatactgatt gtatttttac gctagccaca atttgatata aactatatat 5641 cttccaattt ttttgtacac ctaatgttag ttgaaatatg tgagcgagac gagcaaattt 5701 ttgtagcaaa ctaaaagcgc taaatgttta cttttttata ttattatata tataaatact 5761 tgataaacat atacctaata ttagatctaa actaaactaa ctataaatcg cacacactca 5821 tacactcaca caaaaacaca atgcaataat tgagttacat agttttaaac aaatgttaaa 5881 acattttgct gcaaccgtcg gagatgtagt gtacaatttt tagtttctcg tattattttt 5941 ttttttatgt ctgttttgtg tttaaatttt ttgtaacttt ttacaaagcg taaactgtgt 6001 atgtatgtgc tacattgatt tttgtttaat tatatcaagt ttttatttaa aaaatcgaac 6061 accaccttgc attctcctca tttgaacgtg gcgctcacac ttattactta tataggtcaa 6121 atacagcggg ctctggtgat caatccaatc agcagaaagt aatgaaaaac accgaagtta 6181 atgtttaaac ataaacacac aatgagaaaa gagtcgtgtt tccatattca cttgatttaa 6241 tcggcatgcg atgttactca cagcgaaagg aaattcagca agcttgaatc gataaaattg 6301 ttgtatatat taaatagttt aacactgtgt aattttattt atcctagctc gattctaagt 6361 gcttgcgtaa atgatcattt aaattttcta acccgaaaga acttatttat tggtttattt 6421 atacaaaatt gaaatgaagt gcatatggaa acacaactca aaaacagaca gcacaaatag 6481 aacaacagga acaaatgacc aacgcatttc gaaaggcgat aatcatttac acgaaaaacc 6541 aatataatta aacagaatcc cacgcaaact gaagactaac taacaaccaa gttaagggct 6601 agttaatgga gccggtgcca aagcaaaaaa ggaaaaatga taacaacacc tacacacacg 6661 acaactaaat gtaacaatag caatacattt taatgaaaat tgtagtccaa ataatttgca 6721 tacatttgta ttttgtccaa acttagttga aatgattaac cgaactgtga aagagtgcaa 6781 tagaaatcgt tttgcttcta gattagtgaa aaatacaacg aagcccctaa tttgaatacg 6841 aagcaaccca aaatccccgc cctcccgtaa taacaataaa tacatatgca taattatgca 6901 aaagtttgag aagatgaaac tagaaagtct gtataatgca tacataatat acgactccat 6961 tatacacaca cacacgcata ctaaggccga tgaataacat atgcatatac aatatagaca 7021 tatattaaat atatatcatt gtaataattt gtaatgttta tcagtagaat tatgatccga 7081 ggtggagcag acgagtaaaa cgcatgcaga gatccattaa agtgtactgt aaaatgtgcc 7141 ac