Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001272407 5272 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_001272407 VERSION NM_001272407.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 5272) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 5272) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 5272) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 5272) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 5272) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 5272) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 5272) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 5272) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 5272) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 5272) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 5272) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 5272) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 5272) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 5272) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 5272) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 5272) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 5272) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 5272) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_001272407.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5272 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..5272 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Neuroglian" /map="7F2-7F4" /db_xref="FLYBASE:FBgn0264975" /db_xref="GeneID:31792" CDS 1313..5032 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="CG1634 gene product from transcript CG1634-RH; CG1634-PH; Nrg-PH; icebox; central brain deranged; neuroglian; lethal (1) G0488; female sterile(1)M72" /codon_start=1 /product="neuroglian, isoform H" /protein_id="NP_001259336.1" /db_xref="FLYBASE:FBpp0305702" /db_xref="GeneID:31792" /db_xref="FLYBASE:FBgn0264975" /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL" misc_feature 1397..1696 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1475..1489 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1514..1528 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1592..1606 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1634..1651 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1676..1687 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1721..1960 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1763..1777 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1805..1819 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1886..1900 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1937..1954 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2063..2308 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 2102..2116 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2141..2155 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2225..2239 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2252..2269 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2294..2305 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2327..2593 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 2327..2338 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 2354..2365 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 2378..2401 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 2417..2434 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 2441..2449 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 2471..2485 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 2489..2503 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 2528..2554 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 2561..2593 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 2648..2863 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2657..2671 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2696..2710 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2759..2773 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2801..2818 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2840..2851 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2873..3157 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2924..2938 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2969..2983 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 3041..3055 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 3083..3100 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 3122..3133 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 3149..3433 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature 3359..>4465 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(3398..3403,3407..3412) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(4061..4063,4271..4273,4316..4318) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 4064..4333 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 4433..4645 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(4622..4627,4631..4636) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 4775..5023 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" ORIGIN 1 ggtgtttaag cactaacttt atttattttt tcctaaaaat tccgcgtgta taacataact 61 gtcccagtgt gtgtgtatat gcgtcggtgt tagtgttagt gagcgccggg aattgaaaat 121 aaaatagtaa aaaaaagagg aaaaaaaacg aactgacgcc gcgtagaaaa ttgtcttatt 181 tactccgcca atatataaat tggttttagc tctgccttcg cttttttttt ttagtgtgcg 241 ttcgtgtgtg tgagtgtgcg ggtgtgcttg tctgggaatt gttttaaaaa aataagaaaa 301 attggttgcc aaacgaaagg aagaaaaaaa aacccaaaac aaaattgttt gtctccttgc 361 gttacttcca ccttcatttt ttgttgtttt tttactttgc acactgtgcc gcacccaaaa 421 agttaaatag ttgatggttt tcattaatgc aattgattaa aaatgaatgg caatgcaata 481 ttgtacgaag cacacgatga caacaaaaaa ggagaaggag agcaaatcgg aggacgccaa 541 aagccacgca aaggcaacaa caacagcaac aatgggcgcc attaactgta caagagcgct 601 caaaacctca acatttaaag ctctgtgttt tttttatttt tcctattttt ttgttgtatt 661 ctagttgttt ttgtatgtac atatgtattt accacgaagc caaaacttcg taagcgagtt 721 attgagtggc tccttctcac tcgctccgtc tctcacgctt tggcgcgtcg ccctctcccg 781 ccttcctctc tctctcttac ctgagttttg agttttggat tcttgagcgc tttttggcag 841 aatcccgtca tctagttgtt gttgctgctg ctggcttcta tgacttaaag acatgagacg 901 tgccatatta aaagcgtata ccgcccacac cacccaacag ccataacgcc atttcgttcg 961 cactcacacg ctcgtcgcga cgcgattttc gcaattttca caattgaaaa gtgtaaagtt 1021 ctagacacca ttatcagcgt tgtcataatc tcatttttgc agtgcaacag cagaaagtaa 1081 taaaagctcg gctcgcatgc aattttcatt agtgggaaaa ttgtttgata tttaagaggc 1141 aaccgaggaa taaacggaat caacagcagc agacacacac acacacattc caagccaaat 1201 taataataga aaagaaaaac aaaaaaaaaa aaacagcaac cagaaaacca ataaaagttt 1261 aaaccaaaac gaaacacact cgagggggcg agcggagagc caaacgacca aaatgtggcg 1321 gcagtcaacg atactggccg cgttactagt ggctcttttg tgtgcgggca gtgcagaaag 1381 caaaggcaat cgcccaccaa gaatcaccaa acaaccggca cccggagaat tgctcttcaa 1441 agtggcgcaa cagaataagg aaagtgacaa tccattcata atcgagtgcg aagccgatgg 1501 acaacccgag ccagaatata gttggatcaa gaacggcaag aagttcgatt ggcaggcgta 1561 cgataaccgc atgctgcggc agccaggacg tggcaccctg gtgatcacca tacccaagga 1621 cgaggatcgc ggccactatc agtgctttgc gtccaatgaa ttcggaacgg ccacctcgaa 1681 ctcagtatat gtgcgtaagg ccgagctgaa tgccttcaag gatgaggcgg ccaagacact 1741 ggaggccgtc gagggtgagc cctttatgct gaaatgtgcc gcacccgatg gttttcccag 1801 tccgacagtc aactggatga tccaggagtc catcgatggc agcatcaagt cgatcaacaa 1861 ctctcgcatg accctcgatc ctgagggtaa tctctggttc tcgaatgtta cccgtgagga 1921 tgccagctcc gatttctact atgcctgctc ggccacctcg gtgtttcgca gtgaatacaa 1981 gattggcaac aaggtgctcc tcgatgtcaa acagatgggc gttagtgcct cgcagaacaa 2041 gcatccgccc gtgcgtcaat atgtttcccg tcgccagtcc ttggcgttgc gtggcaagcg 2101 aatggaactg ttttgcatct acggtggaac accgctgccg cagaccgtgt ggagcaagga 2161 tggccagcgt atacagtgga gcgatcgaat aacgcaagga cactatggca aatcactggt 2221 cattcggcag acaaatttcg atgatgccgg cacatacacc tgcgacgtgt ccaacggtgt 2281 gggcaatgcc caatccttct ccatcattct gaatgttaac tccgtgccgt actttaccaa 2341 agaacctgaa atcgccaccg ccgccgaaga cgaagaggtt gtcttcgagt gtcgcgctgc 2401 tggtgtacca gagcccaaga tcagttggat tcacaatggt aagcccatcg agcagagcac 2461 cccgaatccc cgacgaacgg ttacggacaa cacaattcgc attatcaatc tggttaaggg 2521 cgatactggt aactacggtt gcaacgccac caattcgctg ggatatgtgt ataaggatgt 2581 ctatctaaat gtccaggctg agccgccaac gatttccgaa gctccagcag ctgtatccac 2641 tgtcgatgga aggaatgtga ccattaagtg cagggttaac ggttccccca agcctctggt 2701 taaatggcta agggccagca actggctgac cggaggtcgt tacaatgtcc aagctaacgg 2761 tgacctggag atccaagatg tgacattctc ggatgccggc aaatacacat gctatgcgca 2821 gaacaagttt ggtgaaattc aagccgatgg ttcgctggtg gtcaaggagc atacgagaat 2881 tacccaagag ccgcaaaact acgaggtggc cgccggacaa tcggccacgt tccgctgtaa 2941 cgaggcccac gacgatacgc tggagattga gatcgattgg tggaaggatg gccagtccat 3001 tgactttgag gcccagccgc gattcgtgaa gaccaatgat aattccctga cgattgccaa 3061 gacaatggag ttggattctg gcgaatatac gtgcgtggcc cggacgcgtt tggatgaggc 3121 aacggccagg gcgaatttga ttgtccagga tgtgccgaat gcaccaaaac tgaccggcat 3181 cacctgccag gccgacaagg ccgagatcca ctgggaacag cagggtgaca atcgttcgcc 3241 cattctgcac tacaccattc agttcaatac atcgttcacg cccgcctcct gggatgccgc 3301 ctacgagaag gtgcccaaca cggactcctc gttcgtcgtc cagatgtcac cgtgggccaa 3361 ctatacgttc cgtgtgattg ccttcaacaa gatcggagcc tcgccgccgt cggcgcacag 3421 cgatagctgc accacccagc cggatgtgcc cttcaagaat cccgacaatg tcgttggcca 3481 gggcactgag cccaacaatc tggtcatctc gtggactccc atgcccgaaa tcgagcacaa 3541 tgcccccaat ttccattatt atgttagctg gaaacgcgat attcctgccg ctgcgtggga 3601 aaacaataac atattcgact ggcgacagaa caacattgtg attgccgatc aaccgacttt 3661 cgtgaaatac ctgatcaagg tggtggccat caacgatagg ggtgagtcca atgtggccgc 3721 cgaggaggtg gttggctact ctggcgaaga tcgtcccctg gatgcgccca ccaacttcac 3781 aatgaggcaa atcacatcat cgaccagtgg ctacatggcc tggacgccgg taagtgagga 3841 atcggtgcgc ggacacttca agggctacaa aatccaaacg tggacggaga acgagggcga 3901 ggagggtctg cgggagatcc atgtgaaggg tgatacccac aacgctctgg tcacacaatt 3961 caagcccgat tcaaagaact atgcccgcat tttggcttac aatggacgct tcaatggccc 4021 acccagtgcc gtcatcgact tcgatactcc ggagggtgta ccatcgccgg ttcagggact 4081 ggatgcctat cctctgggct cctcggcctt catgctccac tggaagaagc cgctgtatcc 4141 caatggcaag ctcactggct acaagatcta ctacgaggag gttaaggaga gctatgtggg 4201 cgagcgacgc gaatacgatc cacacatcac cgatcccagg gtcacacgca tgaagatggc 4261 cggcctgaag cccaactcca agtaccgcat ctccatcact gccaccacga aaatgggcga 4321 gggatctgaa cactatatcg aaaagaccac gctcaaggat gccgtcaatg tggcccctgc 4381 cacgccatct ttctcctggg agcaactgcc atccgacaat ggactagcca agttccgcat 4441 caactggctg ccaagtaccg agggtcatcc aggcactcac ttctttacga tgcacaggat 4501 caagggcgaa acccaatgga tacgcgagaa tgaggaaaag aactccgatt accaggaggt 4561 cggtggctta gatccggaga ccgcctacga gttccgcgtg gtgtccgtgg atggccactt 4621 taacacggag agtgccacgc aggagatcga cacgaacacc gttgagggac caataatggt 4681 ggccaacgag acggtggcca atgccggatg gttcattggc atgatgctgg ccctggcctt 4741 catcatcatc ctcttcatca tcatctgcat tatccgacgc aatcggggcg gaaagtacga 4801 tgtccacgat cgggagctgg ccaacggccg gcgggattat cccgaagagg gcggattcca 4861 cgagtactcg caaccgttgg ataacaagag cgctggtcgc caatccgtga gttcagcgaa 4921 caaaccgggc gtggaaagcg atactgattc gatggccgaa tacggtgatg gcgatacagg 4981 catgaatgaa gatggatcct ttattggcca atatggacgc aaaggacttt gatttaatta 5041 gtaagcagcg caccgcaaca gcaactcaaa aataatatcg aaaccgagcc cttaacccca 5101 aaaatcaaaa aatcaacaag accaaacacc atcacagcag aaaaatgaaa aaattaatga 5161 aaataatagt agcctacatt ttattcgact ataagtgcaa acaccacgac taatttaaag 5221 tatatataaa aatagaggtt ttatatataa ctattaaaat cttaaaatgt gt