Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster neuroglian, transcript variant H (Nrg),


LOCUS       NM_001272407            5272 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_001272407
VERSION     NM_001272407.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 5272)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5272)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 5272)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 5272)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 5272)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 5272)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 5272)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 5272)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 5272)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 5272)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 5272)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 5272)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 5272)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 5272)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 5272)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 5272)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 5272)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 5272)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_001272407.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5272
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..5272
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Neuroglian"
                     /map="7F2-7F4"
                     /db_xref="FLYBASE:FBgn0264975"
                     /db_xref="GeneID:31792"
     CDS             1313..5032
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="CG1634 gene product from transcript CG1634-RH;
                     CG1634-PH; Nrg-PH; icebox; central brain deranged;
                     neuroglian; lethal (1) G0488; female sterile(1)M72"
                     /codon_start=1
                     /product="neuroglian, isoform H"
                     /protein_id="NP_001259336.1"
                     /db_xref="FLYBASE:FBpp0305702"
                     /db_xref="GeneID:31792"
                     /db_xref="FLYBASE:FBgn0264975"
                     /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV
                     AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK
                     DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG
                     FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF
                     RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP
                     QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN
                     VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD
                     NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT
                     IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE
                     IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE
                     AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT
                     CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA
                     NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI
                     EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE
                     SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT
                     WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE
                     GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI
                     TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE
                     QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP
                     ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII
                     LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK
                     PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL"
     misc_feature    1397..1696
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1475..1489
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1514..1528
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1592..1606
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1634..1651
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1676..1687
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1721..1960
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1763..1777
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1805..1819
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1886..1900
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1937..1954
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2063..2308
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: ig; pfam00047"
                     /db_xref="CDD:395002"
     misc_feature    2102..2116
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2141..2155
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2225..2239
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2252..2269
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2294..2305
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2327..2593
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fourth immunoglobulin (Ig)-like domain of hemolin,
                     and similar domains; a member of the I-set of IgSF
                     domains; Region: IgI_4_hemolin-like; cd20978"
                     /db_xref="CDD:409570"
     misc_feature    2327..2338
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409570"
     misc_feature    2354..2365
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409570"
     misc_feature    2378..2401
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    2417..2434
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    2441..2449
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409570"
     misc_feature    2471..2485
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409570"
     misc_feature    2489..2503
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    2528..2554
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    2561..2593
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    2648..2863
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2657..2671
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2696..2710
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    2759..2773
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2801..2818
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2840..2851
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2873..3157
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2924..2938
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    2969..2983
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    3041..3055
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    3083..3100
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    3122..3133
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    3149..3433
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    3359..>4465
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(3398..3403,3407..3412)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(4061..4063,4271..4273,4316..4318)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    4064..4333
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    4433..4645
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(4622..4627,4631..4636)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    4775..5023
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Bravo-like intracellular region; Region:
                     Bravo_FIGEY; pfam13882"
                     /db_xref="CDD:464016"
ORIGIN      
        1 ggtgtttaag cactaacttt atttattttt tcctaaaaat tccgcgtgta taacataact
       61 gtcccagtgt gtgtgtatat gcgtcggtgt tagtgttagt gagcgccggg aattgaaaat
      121 aaaatagtaa aaaaaagagg aaaaaaaacg aactgacgcc gcgtagaaaa ttgtcttatt
      181 tactccgcca atatataaat tggttttagc tctgccttcg cttttttttt ttagtgtgcg
      241 ttcgtgtgtg tgagtgtgcg ggtgtgcttg tctgggaatt gttttaaaaa aataagaaaa
      301 attggttgcc aaacgaaagg aagaaaaaaa aacccaaaac aaaattgttt gtctccttgc
      361 gttacttcca ccttcatttt ttgttgtttt tttactttgc acactgtgcc gcacccaaaa
      421 agttaaatag ttgatggttt tcattaatgc aattgattaa aaatgaatgg caatgcaata
      481 ttgtacgaag cacacgatga caacaaaaaa ggagaaggag agcaaatcgg aggacgccaa
      541 aagccacgca aaggcaacaa caacagcaac aatgggcgcc attaactgta caagagcgct
      601 caaaacctca acatttaaag ctctgtgttt tttttatttt tcctattttt ttgttgtatt
      661 ctagttgttt ttgtatgtac atatgtattt accacgaagc caaaacttcg taagcgagtt
      721 attgagtggc tccttctcac tcgctccgtc tctcacgctt tggcgcgtcg ccctctcccg
      781 ccttcctctc tctctcttac ctgagttttg agttttggat tcttgagcgc tttttggcag
      841 aatcccgtca tctagttgtt gttgctgctg ctggcttcta tgacttaaag acatgagacg
      901 tgccatatta aaagcgtata ccgcccacac cacccaacag ccataacgcc atttcgttcg
      961 cactcacacg ctcgtcgcga cgcgattttc gcaattttca caattgaaaa gtgtaaagtt
     1021 ctagacacca ttatcagcgt tgtcataatc tcatttttgc agtgcaacag cagaaagtaa
     1081 taaaagctcg gctcgcatgc aattttcatt agtgggaaaa ttgtttgata tttaagaggc
     1141 aaccgaggaa taaacggaat caacagcagc agacacacac acacacattc caagccaaat
     1201 taataataga aaagaaaaac aaaaaaaaaa aaacagcaac cagaaaacca ataaaagttt
     1261 aaaccaaaac gaaacacact cgagggggcg agcggagagc caaacgacca aaatgtggcg
     1321 gcagtcaacg atactggccg cgttactagt ggctcttttg tgtgcgggca gtgcagaaag
     1381 caaaggcaat cgcccaccaa gaatcaccaa acaaccggca cccggagaat tgctcttcaa
     1441 agtggcgcaa cagaataagg aaagtgacaa tccattcata atcgagtgcg aagccgatgg
     1501 acaacccgag ccagaatata gttggatcaa gaacggcaag aagttcgatt ggcaggcgta
     1561 cgataaccgc atgctgcggc agccaggacg tggcaccctg gtgatcacca tacccaagga
     1621 cgaggatcgc ggccactatc agtgctttgc gtccaatgaa ttcggaacgg ccacctcgaa
     1681 ctcagtatat gtgcgtaagg ccgagctgaa tgccttcaag gatgaggcgg ccaagacact
     1741 ggaggccgtc gagggtgagc cctttatgct gaaatgtgcc gcacccgatg gttttcccag
     1801 tccgacagtc aactggatga tccaggagtc catcgatggc agcatcaagt cgatcaacaa
     1861 ctctcgcatg accctcgatc ctgagggtaa tctctggttc tcgaatgtta cccgtgagga
     1921 tgccagctcc gatttctact atgcctgctc ggccacctcg gtgtttcgca gtgaatacaa
     1981 gattggcaac aaggtgctcc tcgatgtcaa acagatgggc gttagtgcct cgcagaacaa
     2041 gcatccgccc gtgcgtcaat atgtttcccg tcgccagtcc ttggcgttgc gtggcaagcg
     2101 aatggaactg ttttgcatct acggtggaac accgctgccg cagaccgtgt ggagcaagga
     2161 tggccagcgt atacagtgga gcgatcgaat aacgcaagga cactatggca aatcactggt
     2221 cattcggcag acaaatttcg atgatgccgg cacatacacc tgcgacgtgt ccaacggtgt
     2281 gggcaatgcc caatccttct ccatcattct gaatgttaac tccgtgccgt actttaccaa
     2341 agaacctgaa atcgccaccg ccgccgaaga cgaagaggtt gtcttcgagt gtcgcgctgc
     2401 tggtgtacca gagcccaaga tcagttggat tcacaatggt aagcccatcg agcagagcac
     2461 cccgaatccc cgacgaacgg ttacggacaa cacaattcgc attatcaatc tggttaaggg
     2521 cgatactggt aactacggtt gcaacgccac caattcgctg ggatatgtgt ataaggatgt
     2581 ctatctaaat gtccaggctg agccgccaac gatttccgaa gctccagcag ctgtatccac
     2641 tgtcgatgga aggaatgtga ccattaagtg cagggttaac ggttccccca agcctctggt
     2701 taaatggcta agggccagca actggctgac cggaggtcgt tacaatgtcc aagctaacgg
     2761 tgacctggag atccaagatg tgacattctc ggatgccggc aaatacacat gctatgcgca
     2821 gaacaagttt ggtgaaattc aagccgatgg ttcgctggtg gtcaaggagc atacgagaat
     2881 tacccaagag ccgcaaaact acgaggtggc cgccggacaa tcggccacgt tccgctgtaa
     2941 cgaggcccac gacgatacgc tggagattga gatcgattgg tggaaggatg gccagtccat
     3001 tgactttgag gcccagccgc gattcgtgaa gaccaatgat aattccctga cgattgccaa
     3061 gacaatggag ttggattctg gcgaatatac gtgcgtggcc cggacgcgtt tggatgaggc
     3121 aacggccagg gcgaatttga ttgtccagga tgtgccgaat gcaccaaaac tgaccggcat
     3181 cacctgccag gccgacaagg ccgagatcca ctgggaacag cagggtgaca atcgttcgcc
     3241 cattctgcac tacaccattc agttcaatac atcgttcacg cccgcctcct gggatgccgc
     3301 ctacgagaag gtgcccaaca cggactcctc gttcgtcgtc cagatgtcac cgtgggccaa
     3361 ctatacgttc cgtgtgattg ccttcaacaa gatcggagcc tcgccgccgt cggcgcacag
     3421 cgatagctgc accacccagc cggatgtgcc cttcaagaat cccgacaatg tcgttggcca
     3481 gggcactgag cccaacaatc tggtcatctc gtggactccc atgcccgaaa tcgagcacaa
     3541 tgcccccaat ttccattatt atgttagctg gaaacgcgat attcctgccg ctgcgtggga
     3601 aaacaataac atattcgact ggcgacagaa caacattgtg attgccgatc aaccgacttt
     3661 cgtgaaatac ctgatcaagg tggtggccat caacgatagg ggtgagtcca atgtggccgc
     3721 cgaggaggtg gttggctact ctggcgaaga tcgtcccctg gatgcgccca ccaacttcac
     3781 aatgaggcaa atcacatcat cgaccagtgg ctacatggcc tggacgccgg taagtgagga
     3841 atcggtgcgc ggacacttca agggctacaa aatccaaacg tggacggaga acgagggcga
     3901 ggagggtctg cgggagatcc atgtgaaggg tgatacccac aacgctctgg tcacacaatt
     3961 caagcccgat tcaaagaact atgcccgcat tttggcttac aatggacgct tcaatggccc
     4021 acccagtgcc gtcatcgact tcgatactcc ggagggtgta ccatcgccgg ttcagggact
     4081 ggatgcctat cctctgggct cctcggcctt catgctccac tggaagaagc cgctgtatcc
     4141 caatggcaag ctcactggct acaagatcta ctacgaggag gttaaggaga gctatgtggg
     4201 cgagcgacgc gaatacgatc cacacatcac cgatcccagg gtcacacgca tgaagatggc
     4261 cggcctgaag cccaactcca agtaccgcat ctccatcact gccaccacga aaatgggcga
     4321 gggatctgaa cactatatcg aaaagaccac gctcaaggat gccgtcaatg tggcccctgc
     4381 cacgccatct ttctcctggg agcaactgcc atccgacaat ggactagcca agttccgcat
     4441 caactggctg ccaagtaccg agggtcatcc aggcactcac ttctttacga tgcacaggat
     4501 caagggcgaa acccaatgga tacgcgagaa tgaggaaaag aactccgatt accaggaggt
     4561 cggtggctta gatccggaga ccgcctacga gttccgcgtg gtgtccgtgg atggccactt
     4621 taacacggag agtgccacgc aggagatcga cacgaacacc gttgagggac caataatggt
     4681 ggccaacgag acggtggcca atgccggatg gttcattggc atgatgctgg ccctggcctt
     4741 catcatcatc ctcttcatca tcatctgcat tatccgacgc aatcggggcg gaaagtacga
     4801 tgtccacgat cgggagctgg ccaacggccg gcgggattat cccgaagagg gcggattcca
     4861 cgagtactcg caaccgttgg ataacaagag cgctggtcgc caatccgtga gttcagcgaa
     4921 caaaccgggc gtggaaagcg atactgattc gatggccgaa tacggtgatg gcgatacagg
     4981 catgaatgaa gatggatcct ttattggcca atatggacgc aaaggacttt gatttaatta
     5041 gtaagcagcg caccgcaaca gcaactcaaa aataatatcg aaaccgagcc cttaacccca
     5101 aaaatcaaaa aatcaacaag accaaacacc atcacagcag aaaaatgaaa aaattaatga
     5161 aaataatagt agcctacatt ttattcgact ataagtgcaa acaccacgac taatttaaag
     5221 tatatataaa aatagaggtt ttatatataa ctattaaaat cttaaaatgt gt