Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001258686 2098 bp mRNA linear INV 26-DEC-2023 B (CG2889), mRNA. ACCESSION NM_001258686 VERSION NM_001258686.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 2098) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2098) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2098) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 2098) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 2098) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 2098) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 2098) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 2098) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 2098) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 2098) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 2098) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 2098) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 2098) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 2098) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 2098) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 2098) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 2098) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 2098) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jan 16, 2013 this sequence version replaced NM_001258686.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2098 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..2098 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /map="9D1-9D1" /db_xref="FLYBASE:FBgn0030206" /db_xref="GeneID:31977" CDS 303..2048 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="CG2889 gene product from transcript CG2889-RB; CG2889-PB" /codon_start=1 /product="uncharacterized protein, isoform B" /protein_id="NP_001245615.1" /db_xref="FLYBASE:FBpp0298822" /db_xref="GeneID:31977" /db_xref="FLYBASE:FBgn0030206" /translation="MICRLCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILP DDGISTSVCTECCEHLEDFNGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVN IDELPLAAGDMDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQ ASDSEPEVTEGQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELADL LDDGGKRRRRKAPDQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSASC DLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTIC KKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTDQLE HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAP AVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLTTNL QCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLRA KMARSHNPQFKPADV" misc_feature 306..539 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zinc-finger associated domain (zf-AD); Region: zf-AD; smart00868" /db_xref="CDD:214871" misc_feature <942..>1172 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="BNR repeat-like domain; Region: BNR_2; pfam13088" /db_xref="CDD:463781" misc_feature 1128..1193 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1128..1130,1137..1139,1176..1178,1191..1193) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1203..>1361 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="N-terminal domain of Oryza sativa transcription factor SUPPRESSOR OF FRI 4 (OsSUF4), Arabidopsis thaliana SUF4 (AtSUF4), and similar proteins; Region: SUF4-like; cd20908" /db_xref="CDD:411020" misc_feature 1203..1271 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 1218..1271 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1224..1226,1230..1232,1236..1238,1242..1247, 1254..1259,1266..1268,1308..1310,1314..1316,1326..1331, 1338..1343,1353..1355,1413..1415,1419..1421,1425..1427, 1431..1436,1443..1448,1455..1457) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature order(1224..1226,1242..1244,1263..1265,1266..1268, 1290..1292,1311..1313) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:411020" misc_feature 1293..1358 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 1293..1358 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1398..1460 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1485..1550 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1485..1487,1494..1496,1533..1535,1548..1550) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1572..1634 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1572..1574,1581..1583,1620..1622,1632..1634) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature 1743..1808 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1743..1745,1752..1754,1791..1793,1806..1808) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:275368" misc_feature order(1758..1760,1764..1766,1770..1772,1776..1781, 1788..1793,1803..1805,1845..1847,1851..1853,1863..1868, 1875..1880,1887..1889,1929..1931,1935..1937,1941..1943, 1947..1952,1959..1964) /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 1830..1892 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1914..1970 /gene="CG2889" /locus_tag="Dmel_CG2889" /gene_synonym="Dmel\CG2889" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 cgttttgatg tgtatccagc gatatattaa gtttcatatt ttcgattttt aattaatgga 61 taatcgttta cagcgtattt tgcagacaat taaaaacgta gaccataaat tgtaagagaa 121 attaaagaga aatactcaac gatcagggtg gccaccccgc aaaaaactcc tgagatgaag 181 ttttgccatt cacaattgga ttctgttatc gattcacgat aggtgaatta tgttgtttac 241 aacgaaaaac tgtttaaatt ttttatttat ttgactttgc gttgtggttc tgttcgcgcg 301 aaatgatttg tcgcctttgc ctgcgatgtc ttagtcccgg aagcgctgtc ttcctctttg 361 agacggacga tacgcttgcg gagacgcgcc tggtcaagat gattgcgaag tttctgcagc 421 tggagatcct accagacgac ggcatctcga ccagcgtctg taccgagtgc tgtgagcatc 481 tggaggactt caatggcttc tggcagctgg tggagcagaa gcagtgctca ctcaagaagg 541 agttccttac cgtggacgtc gactgtgcgg ccatgaagtg gacgggcggt gtggacgtgg 601 acgtcaacat cgacgaactg ccgctggcgg ctggcgacat ggacgagaaa ccgttggacc 661 tgcacaacct tagtctgctg ggaagcgtgc tggacgtgaa tgtggacagt gtggaagtca 721 gggaaccgat caaggagcag ctgccctgcg aggaggagga ggacgagaag ccctgcctgc 781 aagctagtga tagcgaaccg gaggtgaccg aggggcagcc ggaatctgaa tctgactcct 841 cagatgatga acccctggtc cgtctgaaat cgaaaatgaa gcccaagcgc aaaacctcgg 901 cacgttcctc caaggatcag ggtccgatat cgctgcagca ggagcttgca gatctgctcg 961 acgatggtgg caagcgtcgg cgcaggaagg cacctgacca gcgaacaacc accgagtcgc 1021 aggagtccga gctacaggcc gttctcgagc gcaagcccaa gggctgctcc cgtgctcagc 1081 tggccaagag ctacgagaag gccattgcta gctacatgag tgcaagctgc gacctgtgcg 1141 aatttagtgc tccctaccta tccgaattga agacccactt cctggaggtg caccagcgcg 1201 agtactacat caagtgctgc ggcaaagtct ttacacgcgc ttccaagctg atggaccaca 1261 tccgcaaaca tatcaacccc aagctattta cctgcaccat ttgcaagaag tcgctcaact 1321 cgcaggacta cttggccact catatcgaga cggtgcacaa caaggtggct caaatcggca 1381 aggtgctcaa gttcccgtgc cccaagtgcg aacgcacctt cagcagcgag cgccgtatgg 1441 ccaatcatct ggccaagcac gacaccgatc aactggagca cacctgcgag atctgctgca 1501 aaagctttgc caatgtacac cgcctgcgaa ggcacatcca atccatccac gaagacctgc 1561 atcgtcacgt ttgcgacatt tgcgggaaga agttcaagtt caagccctcc ttcgagcgcc 1621 atttgctgga gcaccagggc gtcgtggccc cggctgtgga gtgccccatc tgccgtgttt 1681 ggctgaagaa cgagcacagc ttgcgcctgc accgcttcac acacgacagc acggacaccg 1741 tgtgtccgca ttgtggcaag acctgcacat cgcgcacagc gctccgcggt cacgtcaaat 1801 atgcccacaa gctgaccacc aatctgcagt gcacgttctg cgagaaaacc ttcaagcagc 1861 agcgcaacct ggacgagcac atggccatcc acacgggcct gcagctgtac aactgtccgc 1921 attgccccaa ggagtgccgt tcccgctcca atatgtatgt ccacattaag cagcgtcacg 1981 cggacgagtg gctgcgcgcc aagatggcac gctcgcacaa tccgcagttc aaaccggccg 2041 acgtttaaac ctgacccctc acaattgtgt ttaatcatta tacgtataat taaactgt