Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster uncharacterized protein, transcript variant


LOCUS       NM_001258686            2098 bp    mRNA    linear   INV 26-DEC-2023
            B (CG2889), mRNA.
ACCESSION   NM_001258686
VERSION     NM_001258686.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 2098)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2098)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2098)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 2098)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 2098)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 2098)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 2098)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 2098)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 2098)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 2098)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 2098)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 2098)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 2098)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 2098)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 2098)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 2098)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 2098)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 2098)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 16, 2013 this sequence version replaced NM_001258686.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2098
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..2098
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /map="9D1-9D1"
                     /db_xref="FLYBASE:FBgn0030206"
                     /db_xref="GeneID:31977"
     CDS             303..2048
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="CG2889 gene product from transcript CG2889-RB;
                     CG2889-PB"
                     /codon_start=1
                     /product="uncharacterized protein, isoform B"
                     /protein_id="NP_001245615.1"
                     /db_xref="FLYBASE:FBpp0298822"
                     /db_xref="GeneID:31977"
                     /db_xref="FLYBASE:FBgn0030206"
                     /translation="MICRLCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILP
                     DDGISTSVCTECCEHLEDFNGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVN
                     IDELPLAAGDMDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQ
                     ASDSEPEVTEGQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELADL
                     LDDGGKRRRRKAPDQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSASC
                     DLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTIC
                     KKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTDQLE
                     HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAP
                     AVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLTTNL
                     QCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLRA
                     KMARSHNPQFKPADV"
     misc_feature    306..539
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zinc-finger associated domain (zf-AD); Region:
                     zf-AD; smart00868"
                     /db_xref="CDD:214871"
     misc_feature    <942..>1172
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="BNR repeat-like domain; Region: BNR_2; pfam13088"
                     /db_xref="CDD:463781"
     misc_feature    1128..1193
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1128..1130,1137..1139,1176..1178,1191..1193)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1203..>1361
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="N-terminal domain of Oryza sativa transcription
                     factor SUPPRESSOR OF FRI 4 (OsSUF4), Arabidopsis thaliana
                     SUF4 (AtSUF4), and similar proteins; Region: SUF4-like;
                     cd20908"
                     /db_xref="CDD:411020"
     misc_feature    1203..1271
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:411020"
     misc_feature    1218..1271
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1224..1226,1230..1232,1236..1238,1242..1247,
                     1254..1259,1266..1268,1308..1310,1314..1316,1326..1331,
                     1338..1343,1353..1355,1413..1415,1419..1421,1425..1427,
                     1431..1436,1443..1448,1455..1457)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1224..1226,1242..1244,1263..1265,1266..1268,
                     1290..1292,1311..1313)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:411020"
     misc_feature    1293..1358
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:411020"
     misc_feature    1293..1358
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1398..1460
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1485..1550
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1485..1487,1494..1496,1533..1535,1548..1550)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1572..1634
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1572..1574,1581..1583,1620..1622,1632..1634)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1743..1808
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1743..1745,1752..1754,1791..1793,1806..1808)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1758..1760,1764..1766,1770..1772,1776..1781,
                     1788..1793,1803..1805,1845..1847,1851..1853,1863..1868,
                     1875..1880,1887..1889,1929..1931,1935..1937,1941..1943,
                     1947..1952,1959..1964)
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1830..1892
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1914..1970
                     /gene="CG2889"
                     /locus_tag="Dmel_CG2889"
                     /gene_synonym="Dmel\CG2889"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
        1 cgttttgatg tgtatccagc gatatattaa gtttcatatt ttcgattttt aattaatgga
       61 taatcgttta cagcgtattt tgcagacaat taaaaacgta gaccataaat tgtaagagaa
      121 attaaagaga aatactcaac gatcagggtg gccaccccgc aaaaaactcc tgagatgaag
      181 ttttgccatt cacaattgga ttctgttatc gattcacgat aggtgaatta tgttgtttac
      241 aacgaaaaac tgtttaaatt ttttatttat ttgactttgc gttgtggttc tgttcgcgcg
      301 aaatgatttg tcgcctttgc ctgcgatgtc ttagtcccgg aagcgctgtc ttcctctttg
      361 agacggacga tacgcttgcg gagacgcgcc tggtcaagat gattgcgaag tttctgcagc
      421 tggagatcct accagacgac ggcatctcga ccagcgtctg taccgagtgc tgtgagcatc
      481 tggaggactt caatggcttc tggcagctgg tggagcagaa gcagtgctca ctcaagaagg
      541 agttccttac cgtggacgtc gactgtgcgg ccatgaagtg gacgggcggt gtggacgtgg
      601 acgtcaacat cgacgaactg ccgctggcgg ctggcgacat ggacgagaaa ccgttggacc
      661 tgcacaacct tagtctgctg ggaagcgtgc tggacgtgaa tgtggacagt gtggaagtca
      721 gggaaccgat caaggagcag ctgccctgcg aggaggagga ggacgagaag ccctgcctgc
      781 aagctagtga tagcgaaccg gaggtgaccg aggggcagcc ggaatctgaa tctgactcct
      841 cagatgatga acccctggtc cgtctgaaat cgaaaatgaa gcccaagcgc aaaacctcgg
      901 cacgttcctc caaggatcag ggtccgatat cgctgcagca ggagcttgca gatctgctcg
      961 acgatggtgg caagcgtcgg cgcaggaagg cacctgacca gcgaacaacc accgagtcgc
     1021 aggagtccga gctacaggcc gttctcgagc gcaagcccaa gggctgctcc cgtgctcagc
     1081 tggccaagag ctacgagaag gccattgcta gctacatgag tgcaagctgc gacctgtgcg
     1141 aatttagtgc tccctaccta tccgaattga agacccactt cctggaggtg caccagcgcg
     1201 agtactacat caagtgctgc ggcaaagtct ttacacgcgc ttccaagctg atggaccaca
     1261 tccgcaaaca tatcaacccc aagctattta cctgcaccat ttgcaagaag tcgctcaact
     1321 cgcaggacta cttggccact catatcgaga cggtgcacaa caaggtggct caaatcggca
     1381 aggtgctcaa gttcccgtgc cccaagtgcg aacgcacctt cagcagcgag cgccgtatgg
     1441 ccaatcatct ggccaagcac gacaccgatc aactggagca cacctgcgag atctgctgca
     1501 aaagctttgc caatgtacac cgcctgcgaa ggcacatcca atccatccac gaagacctgc
     1561 atcgtcacgt ttgcgacatt tgcgggaaga agttcaagtt caagccctcc ttcgagcgcc
     1621 atttgctgga gcaccagggc gtcgtggccc cggctgtgga gtgccccatc tgccgtgttt
     1681 ggctgaagaa cgagcacagc ttgcgcctgc accgcttcac acacgacagc acggacaccg
     1741 tgtgtccgca ttgtggcaag acctgcacat cgcgcacagc gctccgcggt cacgtcaaat
     1801 atgcccacaa gctgaccacc aatctgcagt gcacgttctg cgagaaaacc ttcaagcagc
     1861 agcgcaacct ggacgagcac atggccatcc acacgggcct gcagctgtac aactgtccgc
     1921 attgccccaa ggagtgccgt tcccgctcca atatgtatgt ccacattaag cagcgtcacg
     1981 cggacgagtg gctgcgcgcc aagatggcac gctcgcacaa tccgcagttc aaaccggccg
     2041 acgtttaaac ctgacccctc acaattgtgt ttaatcatta tacgtataat taaactgt