Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001258639 1406 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_001258639 VERSION NM_001258639.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1406) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1406) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1406) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 1406) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 1406) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 1406) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 1406) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 1406) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 1406) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 1406) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 1406) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 1406) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 1406) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 1406) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 1406) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 1406) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 1406) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 1406) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jan 16, 2013 this sequence version replaced NM_001258639.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1406 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..1406 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /map="7B7-7B7" /db_xref="FLYBASE:FBgn0029959" /db_xref="GeneID:31684" CDS 306..962 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="CG12156 gene product from transcript CG12156-RB; CG12156-PB; Rab39-PB" /codon_start=1 /product="Rab39, isoform B" /protein_id="NP_001245568.1" /db_xref="FLYBASE:FBpp0298273" /db_xref="GeneID:31684" /db_xref="FLYBASE:FBgn0029959" /translation="MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGV DFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIP LWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARS GANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC " misc_feature 327..959 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab GTPase family 39 (Rab39); Region: Rab39; cd04111" /db_xref="CDD:133311" misc_feature 333..338 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:133311" misc_feature 351..374 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="G1 box; other site" /db_xref="CDD:133311" misc_feature order(357..377,405..407,423..428,507..509,675..680, 684..686,774..782) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133311" misc_feature order(375..410,420..425) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:133311" misc_feature order(405..407,420..446) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Switch I region; other site" /db_xref="CDD:133311" misc_feature order(420..422,432..455,477..479,483..485) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133311" misc_feature 426..428 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="G2 box; other site" /db_xref="CDD:133311" misc_feature order(429..431,435..443,489..491,495..497,516..521, 528..530,540..542,546..557,828..830) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="putative effector interaction site [active]" /db_xref="CDD:133311" misc_feature order(429..434,438..440,495..500,519..521,525..527, 531..539) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:133311" misc_feature 429..443 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:133311" misc_feature 483..497 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:133311" misc_feature 498..509 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="G3 box; other site" /db_xref="CDD:133311" misc_feature order(507..509,513..545) /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Switch II region; other site" /db_xref="CDD:133311" misc_feature 516..533 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:133311" misc_feature 540..554 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:133311" misc_feature 567..584 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:133311" misc_feature 654..668 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:133311" misc_feature 675..686 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="G4 box; other site" /db_xref="CDD:133311" misc_feature 774..782 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="G5 box; other site" /db_xref="CDD:133311" misc_feature 822..830 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:133311" misc_feature 951..959 /gene="Rab39" /locus_tag="Dmel_CG12156" /gene_synonym="24640395; AAF46271; CG12156; Dmel\CG12156; DmRab39; rab39" /note="putative lipid modification site [posttranslational modification]; other site" /db_xref="CDD:133311" ORIGIN 1 ttatcacaca cacgcgcacg catatgagaa aaaaacacaa aacaaaacaa aattcgaagg 61 aatttgaatt ctcgaatatt tataatttaa caaccaccag cgacagccgg aaatatctca 121 ttgcaaagcc agtaatcgtg tgaagaacag aaagtttcga tttgcaatac aactgcagga 181 aataagaaga aaaacgagca gcataagcaa atcaacgatt tgcgtatcaa actttacaaa 241 gggaaggcag attttttgct gcggattcaa ttccaagaga caaatccctc gaattcggct 301 tcggaatggt ggaacccatt ttcgagtatc aatttcgact gattttaatc ggcgacagca 361 ccgtgggcaa gagctcgctg ctcaaattct tcacagacgg caaattcgcc gagttatccg 421 atcccacagt tggcgtcgac ttctttgccc gcctcatcga aatgaaggac ggcacacaga 481 tcaagctcca gctgtgggac actgctggcc aagagcgctt ccgttcgatc accaagtcct 541 actaccggaa ctcggttggc gtgctgctgg tctacgacat atcgaatcac gccagcttcg 601 agcacatacc gctgtggatg atggaggcac agcgtcacat tgagccccac cgccccgttt 661 tcgcattggt cggctgcaaa ctggacctca tcaatgcggg cggacaccgg gaggtgacca 721 cagaggaggc acaaaaattt gccaaacagc acggtctgca tttcgttgag acatcggccc 781 ggtctggtgc caatgtggag gaggcatttc gcatggtcac ccaggaggtg tacgcccgca 841 ttcgatccgg cgaatataag gcggaggatg gatgggacgg catcaagtct ggcttttcgc 901 gacccaatag tctggacttt aatctcgtcg tagcagagcc ggaaaagtca tcatgttgtt 961 gattcacccc gacctcattg tctattattt tcaatactgt ttatgtacat tgatttgtat 1021 cgtatgaccc accagtactc cttttccccc ctaaacacca atttgttgac tctttaatct 1081 tgtttaatcg tctagtttag ctaaaaaacc aaaacagtta cgtatattta cacaatgcgt 1141 tttttttcta attacatata gttaatcgct tttaagttaa tatttagttc ggtgactcac 1201 ggtaattagt gaagattgag tttgaacccc tctttccaaa ttatgtttac ttcgccccta 1261 taattgatag ccagtcacac gaggtatacg tagccgagat tctgcgctcc taactcatac 1321 aacacataac tccacataca caaatacgaa aggaaaagct atacatatac ttaaaacttg 1381 aaatataaac gtttttatta atacgg