Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001258581 9611 bp mRNA linear INV 26-DEC-2023 ACCESSION NM_001258581 VERSION NM_001258581.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 9611) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 9611) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 9611) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 9611) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 9611) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 9611) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 9611) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 9611) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 9611) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 9611) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 9611) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 9611) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 9611) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 9611) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 9611) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 9611) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 9611) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 9611) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jul 15, 2014 this sequence version replaced NM_001258581.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..9611 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..9611 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Notch" /map="3C7-3C9" /db_xref="FLYBASE:FBgn0004647" /db_xref="GeneID:31293" CDS 799..8910 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="CG3936 gene product from transcript CG3936-RB; CG3936-PB; N-PB; chopped; strawberry; NICD; facet; confluens; notchoid; abruptex; split; dNotch" /codon_start=1 /product="notch, isoform B" /protein_id="NP_001245510.1" /db_xref="FLYBASE:FBpp0293201" /db_xref="GeneID:31293" /db_xref="FLYBASE:FBgn0004647" /translation="MQSQRSRRRSRAPNTWICFWINKMHAVASLPASLPLLLLTLAFA NLPNTVRGTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNS MRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLE EYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDI EECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLS YECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDE CAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVG SFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDI DECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPG TFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINID DCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFK CLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECH SNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCE CPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSN PCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCK VPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLS SPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLC VDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESS CLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPS GFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADR KGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGA YECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDD CKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNN YHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQD CDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGD YECLCPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNG ICDSDCNTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDC ERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVM LMNVEAFREIQAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARK NKILYTQQVHQTGIQIYLEIDNRKCTECFTHAVEAAEFLAATAAKHQLRNDFQIHSVR GIKNPGDEDNGEPPANVKYVITGIILVIIALAFFGMVLSTQRKRAHGVTWFPEGFRAP AAVMSRRRRDPHGQEMRNLNKQVAMQSQGVGQPGAHWSDDESDMPLPKRQRSDPVSGV GLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAIMTPPAHQDGGKHDVDARGP CGLTPLMIAAVRGGGLDTGEDIENNEDSTAQVISDLLAQGAELNATMDKTGETSLHLA ARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNRATNLNARMH DGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNNTEAVNILLMHH ANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDI VRLLDEHVPRSPQMLSMTPQAMIGSPPPGQQQPQLITQPTVISAGNGGNNGNGNASGK QSNQTAKQKAAKKAKLIEGSPDNGLDATGSLRRKASSKKTSAASKKAANLNGLNPGQL TGGVSGVPGVPPTNSAAQAAAAAAAAVAAMSHELEGSPVGVGMGGNLPSPYDTSSMYS NAMAAPLANGNPNTGAKQPPSYEDCIKNAQSMQSLQGNGLDMIKLDNYAYSMGSPFQQ ELLNGQGLGMNGNGQRNGVGPGVLPGGLCGMGGLSGAGNGNSHEQGLSPPYSNQSPPH SVQSSLALSPHAYLGSPSPAKSRPSLPTSPTHIQAMRHATQQKQFGGSNLNSLLGGAN GGGVVGGGGGGGGGVGQGPQNSPVSLGIISPTGSDMGIMLAPPQSSKNSAIMQTISPQ QQQQQQQQQQQQHQQQQQQQQQQQQQQQQQLGGLEFGSAGLDLNGFCGSPDSFHSGQM NPPSIQSSMSGSSPSTNMLSPSSQHNQQAFYQYLTPSSQHSGGHTPQHLVQTLDSYPT PSPESPGHWSSSSPRSNSDWSEGVQSPAANNLYISGGHQANKGSEAIYI" misc_feature 1333..1440 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 1447..1554 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(1447..1449,1456..1458,1498..1500) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 1576..1671 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 1681..1785 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 1789..1905 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(1789..1791,1798..1800,1849..1851) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2143..2256 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2143..2145,2152..2154,2197..2199) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2260..2370 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2260..2262,2269..2271,2311..2313) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2374..2484 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2374..2376,2383..2385,2425..2427) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2488..2598 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2488..2490,2497..2499,2539..2541) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2602..2709 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2602..2604,2611..2613,2650..2652) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2716..2823 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 2827..2937 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2827..2829,2836..2838,2878..2880) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 2941..3048 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(2941..2943,2950..2952,2992..2994) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3055..3165 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3055..3057,3064..3066,3106..3108) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3169..3279 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3169..3171,3178..3180,3220..3222) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3283..3393 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3283..3285,3292..3294,3334..3336) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3517..3627 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3517..3519,3526..3528,3571..3573) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3634..3744 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3634..3636,3643..3645,3685..3687) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3748..3858 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(3748..3750,3757..3759,3799..3801) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 3877..3972 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 3982..4083 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 4348..4455 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 4459..4569 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(4459..4461,4468..4470,4510..4512) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 4573..4683 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(4573..4575,4582..4584,4624..4626) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 4687..4803 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature order(4687..4689,4696..4698,4744..4746) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238011" misc_feature 4810..4917 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 5047..5148 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the...; Region: EGF_CA; cd00054" /db_xref="CDD:238011" misc_feature 5224..5334 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Domain found in Notch and Lin-12; Region: NL; smart00004" /db_xref="CDD:197463" misc_feature 5353..5457 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="LNR domain; Region: Notch; pfam00066" /db_xref="CDD:459658" misc_feature 5491..5577 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="LNR domain; Region: Notch; pfam00066" /db_xref="CDD:459658" misc_feature 5590..5754 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="NOTCH protein; Region: NOD; pfam06816" /db_xref="CDD:462014" misc_feature 5833..5991 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="NOTCH protein; Region: NODP; pfam07684" /db_xref="CDD:462229" misc_feature 5953..6216 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="juxtamembrane and transmembrane (JMTM) domain found in Drosophila melanogaster neurogenic locus Notch protein (dNotch) and similar proteins; Region: JMTM_dNotch; cd21706" /db_xref="CDD:411989" misc_feature order(5956..5964,5971..5979,6037..6042,6046..6048, 6052..6078,6085..6090,6097..6105) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="putative polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:411989" misc_feature 6502..6642 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 6604..7215 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="Ankyrin repeat [Signal transduction mechanisms]; Region: ANKYR; COG0666" /db_xref="CDD:440430" misc_feature 6649..6741 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 6748..6843 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature order(6847..6849,6853..6855,6865..6870,6877..6885, 6889..6894,6904..6906,6913..6915,6940..6942,6946..6948, 6952..6954,6964..6969,6976..6984,6988..6993,7003..7005, 7012..7014,7039..7041,7045..7047,7051..7053,7063..7068, 7075..7083,7087..7092,7102..7104,7111..7113,7138..7140) /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:293786" misc_feature 6847..6942 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 6946..7041 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 7045..7140 /gene="N" /locus_tag="Dmel_CG3936" /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12; Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936; dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax; l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd; spl; swb" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" ORIGIN 1 acagatcgct tttttccagt ggacgaaacg gttgtgaaag cggacgagcg ttaggcagac 61 gaacctggaa agcgcagagc acagttctca acatttattt tttttttgaa tgtgtgtgca 121 acaacgcacg taaaatcgcg ctgccaacag gatatacaaa caaatcaatt acacagcaag 181 caaatgcaat gaaatgaaaa ggatggcccc agcgggaaag ccgttcagca agagcaagga 241 gtgcctgtcg cagggatagc aacgagagag cgacacagag agcgagagag agagagggag 301 agaaacaagg attttcgaaa agtgtatcta cctcgagtcg cgcgtgtgtg agagtgagac 361 gaaagccgag tgcaagaagc gcaagaggaa gagagcaata cgcaagcgtg cggcgtcggt 421 ttgaatttga atttgtggct cgatcctcgc gaagagaaaa gcaagcaaaa gatacacgaa 481 aagcgttctt tttttgccac ttttttttta tgtttcaaaa cggaaaatgt cgccgtcgtc 541 gggagagtgc ctcctcttag tttatcaaat aaagctttaa agtctgaagt tcaaaactat 601 aaaaaacaaa aaaaaaaaca aaaaaacaac aaacgcgcta aaacaaaaaa ttgcttaaac 661 tactgagact agcatactaa acctaaactc gcagttaaac atatcctcaa agagagacca 721 aagaggagcg ctaaagaaac cgagaagcga gtagaggtga aaaactggaa aagtggttaa 781 ctggaaaact ggattacaat gcaatcgcag cgcagccgac gtcgcagtcg cgcaccaaac 841 acttggattt gtttttggat taacaaaatg cacgccgttg cgtcgctgcc ggcgtcgctg 901 cctctgctgc tgttgacgct ggcgtttgcg aatttgccaa acaccgttcg cggaactgat 961 accgcgttgg tggccgcttc ctgcacaagt gtcggttgcc agaatggcgg cacatgcgtt 1021 acacaactca atggcaaaac ctactgcgca tgcgattcgc actatgtcgg cgactactgt 1081 gaacaccgca atccgtgcaa ttcgatgcgt tgccaaaatg gtggcacctg tcaggtgacc 1141 tttcgcaacg gccgtccggg catctcgtgc aagtgtcctt tgggcttcga cgagtccctg 1201 tgcgaaattg cggtaccgaa tgcctgcgat catgtgacct gcctcaatgg aggcacctgt 1261 cagctaaaga cactggagga gtacacgtgt gcgtgtgcca atggctatac aggtgaacga 1321 tgcgagacga agaatctgtg cgcaagttct ccctgccgga atggagccac ctgcaccgct 1381 ttggccggaa gcagcagctt cacctgctcc tgtccgccgg gcttcaccgg tgacacctgt 1441 tcctatgaca tcgaggagtg ccagtcgaat ccgtgcaaat acggcggcac atgtgtcaac 1501 acccacggat cttaccagtg catgtgtccc acgggctaca cgggaaagga ttgcgacacc 1561 aagtacaagc cctgctcgcc atcgccgtgc cagaatggcg gaatttgccg gtcgaacggt 1621 ctgtcctacg agtgcaagtg ccccaaaggt ttcgagggca agaactgcga acagaactac 1681 gacgattgcc tgggacatct ttgccagaac ggaggaacct gcatcgatgg catctcggac 1741 tacacctgcc gctgtccacc gaacttcacg ggcagattct gccaggacga tgtggacgag 1801 tgcgcccaac gggatcatcc ggtgtgccag aacggagcca cctgtacaaa cactcacgga 1861 tcgtacagct gcatctgcgt gaatggctgg gcgggcttgg actgcagcaa caacacggat 1921 gactgcaaac aggcggcctg tttctacgga gccacgtgca tcgatggcgt tggcagcttc 1981 tattgccagt gtacgaaggg caagacgggt ctgttgtgcc acctggacga tgcctgtacc 2041 tcgaatccct gccatgcgga cgccatttgt gacacgagtc cgataaacgg ctcctatgcc 2101 tgttcctgtg ccaccggcta caagggcgtg gattgttcag aggacataga tgaatgcgat 2161 cagggatcac cgtgcgaaca caatggcata tgcgtgaaca caccgggcag ctacagatgc 2221 aattgctccc agggctttac gggtccgcgc tgcgagacga acatcaatga gtgcgaatcg 2281 catccatgcc agaacgaggg atcttgcctg gatgatccgg gaacgttccg atgcgtctgt 2341 atgccaggat tcacgggcac acagtgcgaa atcgacattg acgaatgcca atcgaatccc 2401 tgcttgaacg atggaacttg ccacgacaag atcaatggct ttaaatgcag ttgtgccctg 2461 ggctttacgg gcgcacgatg tcaaatcaat atagacgact gtcagtcgca accatgccgg 2521 aatcgtggca tctgtcacga ctctatagcg ggctacagct gcgaatgtcc gccgggatat 2581 acgggcacca gttgcgagat caatatcaac gattgcgatt cgaatccctg ccatcggggc 2641 aagtgcatcg acgatgtgaa cagtttcaag tgcctctgtg atcccggcta cacgggctac 2701 atatgccaga agcagatcaa cgaatgcgaa tcgaatccgt gccagttcga tggccattgc 2761 caggatcgtg tgggcagcta ctattgtcag tgccaggcgg gaaccagtgg caagaattgc 2821 gaggtcaatg tgaacgaatg ccacagtaat ccctgcaaca atggtgccac ctgcatcgat 2881 ggcatcaatt cgtacaagtg ccagtgtgtg cccggtttta cgggtcagca ctgcgagaag 2941 aacgtcgacg agtgcattag cagtccgtgt gccaacaatg gtgtctgcat agatcaggtg 3001 aatggctaca agtgcgagtg tccgcgtgga ttctacgatg cccattgcct gagcgatgtg 3061 gacgagtgcg catcgaatcc gtgcgtgaac gagggacgtt gcgaggatgg aatcaatgag 3121 ttcatctgcc actgtccgcc aggatacacg ggcaagcgtt gtgagctgga catagacgag 3181 tgcagcagca atccctgcca gcatggtggc acctgttatg ataagctcaa cgccttcagt 3241 tgccaatgca tgccgggcta tacgggccaa aagtgcgaaa cgaatattga cgactgtgtg 3301 accaatccgt gcggaaatgg aggcacctgc attgacaagg tcaacggcta caagtgcgtc 3361 tgcaaagtgc ccttcacggg cagggattgt gaaagcaaaa tggatccctg cgccagcaat 3421 cgttgcaaaa acgaggcgaa atgcacgcca agctcgaatt tcctggactt ctcctgcacc 3481 tgcaaactgg gctatacggg tcgctattgc gatgaggaca tagacgaatg ctcactgagt 3541 tcaccctgtc ggaatggagc tagctgtttg aatgttcccg gatcgtatag gtgcctctgc 3601 accaagggct atgagggcag agattgcgcc atcaatacgg acgattgtgc ctcgtttccg 3661 tgccagaacg gtggaacctg tctggatggg atcggtgact atagctgcct gtgcgtggat 3721 ggcttcgatg gcaagcactg cgagacggac atcaatgagt gcttgagtca gccgtgccag 3781 aatggagcca cgtgtagtca gtatgtgaat agctatacct gcacctgtcc actcggattc 3841 tccggcatca attgtcagac gaacgatgag gattgcacgg agagctcgtg cttaaacggt 3901 ggcagttgca tcgatggcat caatggctac aactgtagct gtttggctgg atattccggt 3961 gccaattgtc agtacaagtt gaataagtgc gattcgaatc cctgtttgaa cggagccacc 4021 tgccacgagc aaaacaacga gtacacatgc cattgtccca gtggctttac gggcaaacag 4081 tgttccgaat atgtggattg gtgtggtcaa tcgccgtgcg agaatggagc gacctgtagc 4141 cagatgaagc atcagtttag ctgcaaatgc tcggcaggat ggacgggtaa gctgtgcgat 4201 gttcagacga tttcgtgtca ggatgcagca gatcggaagg gtctgagcct gcggcagttg 4261 tgcaacaatg gcacgtgcaa ggattatgga aatagtcatg tgtgctactg ctcccaggga 4321 tacgcgggta gctattgcca aaaggagatc gacgagtgcc aatcgcaacc gtgccagaat 4381 ggtggaacgt gccgagatct catcggagcc tacgaatgcc agtgtcgcca gggatttcag 4441 ggtcagaatt gcgaactgaa catcgatgac tgtgcaccga atccctgcca gaatggcggc 4501 acttgccacg accgtgtgat gaactttagc tgcagctgtc caccgggaac gatgggcatc 4561 atatgcgaga tcaacaagga tgattgcaaa ccgggagcat gccacaacaa cggcagctgc 4621 atcgatcgcg ttggaggctt cgagtgcgtc tgtcagcccg gttttgtggg tgcccgctgc 4681 gagggcgaca tcaacgagtg cctaagcaat ccctgttcga atgccggcac actggactgc 4741 gtccagttgg tcaataacta tcactgcaac tgtcgacctg gacatatggg tcggcactgt 4801 gagcacaagg tggacttttg tgcccagagt ccgtgccaga atggtggcaa ttgtaatatc 4861 cgacagagtg gccaccactg catctgtaat aatggattct acggtaagaa ctgtgagctg 4921 agtggtcagg attgtgattc gaatccctgc cgtgtgggta actgtgttgt cgcggacgag 4981 ggattcggct atagatgcga gtgtccaagg ggcacactgg gtgagcactg cgagattgat 5041 acgctagacg aatgttcgcc gaatccctgt gcccagggag ctgcctgcga ggatttgctc 5101 ggtgattacg aatgcctctg tccgagcaaa tggaaaggca aacgctgcga tatctatgat 5161 gccaactatc cgggatggaa tggcggttcg ggatccggaa atgatcgcta tgccgctgat 5221 ttggagcaac aacgtgccat gtgcgataag cgaggttgca ccgaaaagca gggcaacggc 5281 atttgcgatt ccgattgcaa tacgtatgcc tgcaactttg atggaaacga ttgctcactg 5341 ggcatcaatc cgtgggccaa ttgcacggcc aacgagtgct ggaacaaatt caagaacggc 5401 aaatgcaacg aggagtgcaa caatgctgcc tgccactacg atggtcacga ttgcgaacgg 5461 aaattgaaga gttgcgatag ccttttcgat gcctactgcc agaagcatta cggcgatggt 5521 ttctgcgact atggatgcaa taatgcggaa tgcagttggg acggactcga ctgtgagaac 5581 aagacccagt caccggtttt ggccgagggt gccatgtccg tggtgatgct aatgaatgtg 5641 gaggcattcc gcgagattca ggctcagttc cttaggaata tgagccacat gctgcggaca 5701 acggtgcggt tgaagaagga cgctcttggt catgacatca ttatcaattg gaaggacaat 5761 gtgcgcgtgc cggagatcga ggatacggac tttgcgagaa aaaacaagat tctgtacacc 5821 caacaggtcc atcagacggg cattcaaatc tatttggaga ttgacaatcg caaatgcacc 5881 gaatgcttta cgcacgccgt tgaggcagcc gaatttctgg ctgccacggc ggccaaacat 5941 cagctgcgga acgattttca gatacacagt gttaggggca tcaagaatcc cggcgatgag 6001 gacaatggtg agccgccggc gaatgtgaaa tacgtaatta ctggcattat actggtcatc 6061 attgcattgg ccttctttgg catggtcttg agtacgcaaa gaaagcgggc acatggcgtc 6121 acctggttcc cggagggatt ccgtgcaccg gcggcggtta tgtcgcgacg tcgacgtgat 6181 ccacacggcc aagagatgcg gaatctcaac aagcaggtgg ccatgcaatc gcagggtgtt 6241 ggccagccag gtgctcattg gtccgacgat gaatcggata tgccgttgcc caagcgacag 6301 cgcagtgatc ccgtttccgg tgtcggtctg ggcaacaatg gtggctatgc cagtgatcat 6361 acaatggtca gcgaatatga ggaggctgat cagcgggtct ggtcgcaggc ccatctggat 6421 gtggtcgatg tgcgggccat aatgacaccg ccggcgcatc aggatggtgg caagcacgat 6481 gtggatgcac gtggaccttg cggactgact ccgctaatga ttgctgccgt acgaggcggt 6541 ggcctggaca ctggcgagga tatcgagaac aatgaggaca gtactgccca ggtgatatcg 6601 gatctattgg cacagggagc cgagttaaat gccacaatgg ataaaacggg cgagacatca 6661 ttgcatttgg cagcacgttt tgctcgagca gatgccgcca agagattatt ggacgccggt 6721 gcggatgcca attgtcagga taacacgggc aggacaccgc tgcacgctgc tgtggccgcc 6781 gatgccatgg gtgtatttca gatattgctt aggaataggg ctaccaatct aaatgctaga 6841 atgcatgacg gcacaacgcc actaatactg gccgctcgtc tagccatcga gggcatggtg 6901 gaggatttga tcacagccga tgcggatatt aatgcagcgg ataattccgg caagaccgct 6961 ctccattggg cagcggcggt taacaatacc gaagcggtga acattctgct aatgcatcat 7021 gccaatcgcg atgcccagga cgataaggat gagacaccgc tgtttctggc cgcacgcgag 7081 ggtagctatg aggcgtgcaa ggcgctgttg gataattttg ccaatcgcga gattaccgat 7141 cacatggatc gattgccacg cgatgtggcc agcgagcgac tgcatcacga tattgtcagg 7201 ctgctggacg agcatgtgcc gcgatctccg caaatgctga gcatgacacc gcaggcaatg 7261 atcggatccc cgccgccggg tcaacagcag ccgcagttga tcacacagcc gacggtcatt 7321 tccgccggaa atggtggcaa caatggcaat ggcaatgcca gcggaaagca gagcaaccaa 7381 acggccaaac agaaggcggc caagaaggcc aaactaatcg agggcagtcc ggacaatggg 7441 ctggatgcca cgggcagttt gcgacgcaag gcaagttcaa aaaagacaag tgcggcctca 7501 aaaaaggccg ccaacttgaa tggcctaaat ccgggccagc tgacgggggg agtgtcgggc 7561 gtgccgggtg taccgccaac gaattcagcg gcacaagcag ctgcagcggc agcggcagcc 7621 gtggcggcca tgtcccacga actggagggt tcgccggtgg gcgtgggcat gggcgggaat 7681 ctgcccagtc cgtacgacac cagttcgatg tactcgaatg cgatggccgc accgctggcg 7741 aacggcaatc cgaacacggg cgccaagcag ccgccgagct atgaggattg catcaagaat 7801 gcgcaatcga tgcaatcgct gcagggcaat ggtctggata tgatcaagct ggataattat 7861 gcctactcga tgggctcgcc atttcagcag gagctgctca atggccaagg actcgggatg 7921 aatggtaatg gccagcgaaa tggagtcggt cccggcgttc tgcccggcgg cctatgcgga 7981 atgggcggtc tgagtggagc cggcaatgga aatagccacg aacagggact gagtccgccg 8041 tactcgaatc agtcgccgcc gcattcggtg cagagcagcc tggcgctatc gccccacgcc 8101 tacttgggct cgccatcgcc ggccaagtcg cgacccagtc tacccacctc gcccacccac 8161 attcaggcga tgaggcatgc cacacagcag aagcaattcg gtggcagtaa tctgaatagt 8221 ttgctgggcg gtgccaatgg cgggggcgtg gtcggcggag gaggaggtgg tggtggtggt 8281 gttggccagg ggccacaaaa ctcacccgta agcttgggaa tcatctcgcc gacgggcagc 8341 gatatgggca tcatgctcgc cccgccccaa tcctcgaaga atagtgcaat aatgcaaacg 8401 atatcacccc agcaacagca gcagcagcag caacagcaac agcagcaaca tcagcagcag 8461 caacagcagc agcaacagca gcagcagcaa cagcagcagc aactcggagg cctggagttc 8521 ggttcagcgg gcttggacct gaatggattt tgtggatctc cggactcatt tcactcgggt 8581 caaatgaatc cgccctcgat acaaagttca atgtccggct catcgccgtc gaccaatatg 8641 ttgtcgccgt cgtcgcagca caatcagcag gccttctacc agtacctaac gccttcgagc 8701 caacattccg gcggccatac gccgcagcat ttggtccaaa cgttggatag ctatccgacg 8761 ccctcgccgg agtcacctgg ccactggtcc tcctcgtcgc cgcgatcgaa ttccgattgg 8821 agcgagggcg ttcagtcgcc ggcggcaaat aatctttaca tatccggtgg ccatcaggct 8881 aacaagggtt ccgaggccat ctacatttga ccgtgatctg gatgatttgg tatgttgaat 8941 atcgcgcaag gataattgga tggcttgcca aggataacag caaaagggga ctcttaaaga 9001 gtccgcggct aagttcgatc taaaatatgc tatatattgt aattctctaa tctctacgga 9061 ttatgtattt tttccaacga ctcttttttt ttttttttga gtgtgtctat aagttttaga 9121 tgttagtgcg aaatacgcaa ttctagcgga agaagcgtca taaattgtag taacttaaat 9181 tttatttaat gcttgttgta cagtgcgcgc cgatcgcata tatatatata tatatagata 9241 ttgatataga tatatgtata tctactcata gatataccag ttaagagctc gtcttgtggc 9301 gcattttatt ttattgtcgt aacgtcatcg tagcttccag taaaaaaaaa aacaaaaaac 9361 aaaagaatca acataaaaag atgagcaact aaacttagcg caaattctga ttggatcgat 9421 taaacgtttg tgggacaatt tgtagttgta agtgaccatt atatcactag gccataagac 9481 tacgctaagt tttttttatc gaattctaca ttattaatta tggccccaca tgctatatat 9541 aaatacataa atttcgtagt tctgtaggtt ttgaaactga agtgcttata taaacaaaat 9601 tgttagaccg t