Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster notch, transcript variant B (N), mRNA.


LOCUS       NM_001258581            9611 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_001258581
VERSION     NM_001258581.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 9611)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 9611)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 9611)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 9611)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 9611)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 9611)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 9611)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 9611)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 9611)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 9611)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 9611)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 9611)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 9611)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 9611)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 9611)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 9611)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 9611)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 9611)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_001258581.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..9611
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..9611
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Notch"
                     /map="3C7-3C9"
                     /db_xref="FLYBASE:FBgn0004647"
                     /db_xref="GeneID:31293"
     CDS             799..8910
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="CG3936 gene product from transcript CG3936-RB;
                     CG3936-PB; N-PB; chopped; strawberry; NICD; facet;
                     confluens; notchoid; abruptex; split; dNotch"
                     /codon_start=1
                     /product="notch, isoform B"
                     /protein_id="NP_001245510.1"
                     /db_xref="FLYBASE:FBpp0293201"
                     /db_xref="GeneID:31293"
                     /db_xref="FLYBASE:FBgn0004647"
                     /translation="MQSQRSRRRSRAPNTWICFWINKMHAVASLPASLPLLLLTLAFA
                     NLPNTVRGTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNS
                     MRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLE
                     EYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDI
                     EECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLS
                     YECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDE
                     CAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVG
                     SFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDI
                     DECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPG
                     TFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINID
                     DCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFK
                     CLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECH
                     SNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCE
                     CPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSN
                     PCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCK
                     VPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLS
                     SPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLC
                     VDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESS
                     CLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPS
                     GFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADR
                     KGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGA
                     YECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDD
                     CKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNN
                     YHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQD
                     CDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGD
                     YECLCPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNG
                     ICDSDCNTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDC
                     ERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVM
                     LMNVEAFREIQAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARK
                     NKILYTQQVHQTGIQIYLEIDNRKCTECFTHAVEAAEFLAATAAKHQLRNDFQIHSVR
                     GIKNPGDEDNGEPPANVKYVITGIILVIIALAFFGMVLSTQRKRAHGVTWFPEGFRAP
                     AAVMSRRRRDPHGQEMRNLNKQVAMQSQGVGQPGAHWSDDESDMPLPKRQRSDPVSGV
                     GLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAIMTPPAHQDGGKHDVDARGP
                     CGLTPLMIAAVRGGGLDTGEDIENNEDSTAQVISDLLAQGAELNATMDKTGETSLHLA
                     ARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNRATNLNARMH
                     DGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNNTEAVNILLMHH
                     ANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDI
                     VRLLDEHVPRSPQMLSMTPQAMIGSPPPGQQQPQLITQPTVISAGNGGNNGNGNASGK
                     QSNQTAKQKAAKKAKLIEGSPDNGLDATGSLRRKASSKKTSAASKKAANLNGLNPGQL
                     TGGVSGVPGVPPTNSAAQAAAAAAAAVAAMSHELEGSPVGVGMGGNLPSPYDTSSMYS
                     NAMAAPLANGNPNTGAKQPPSYEDCIKNAQSMQSLQGNGLDMIKLDNYAYSMGSPFQQ
                     ELLNGQGLGMNGNGQRNGVGPGVLPGGLCGMGGLSGAGNGNSHEQGLSPPYSNQSPPH
                     SVQSSLALSPHAYLGSPSPAKSRPSLPTSPTHIQAMRHATQQKQFGGSNLNSLLGGAN
                     GGGVVGGGGGGGGGVGQGPQNSPVSLGIISPTGSDMGIMLAPPQSSKNSAIMQTISPQ
                     QQQQQQQQQQQQHQQQQQQQQQQQQQQQQQLGGLEFGSAGLDLNGFCGSPDSFHSGQM
                     NPPSIQSSMSGSSPSTNMLSPSSQHNQQAFYQYLTPSSQHSGGHTPQHLVQTLDSYPT
                     PSPESPGHWSSSSPRSNSDWSEGVQSPAANNLYISGGHQANKGSEAIYI"
     misc_feature    1333..1440
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1447..1554
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(1447..1449,1456..1458,1498..1500)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1576..1671
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1681..1785
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1789..1905
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(1789..1791,1798..1800,1849..1851)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2143..2256
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2143..2145,2152..2154,2197..2199)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2260..2370
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2260..2262,2269..2271,2311..2313)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2374..2484
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2374..2376,2383..2385,2425..2427)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2488..2598
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2488..2490,2497..2499,2539..2541)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2602..2709
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2602..2604,2611..2613,2650..2652)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2716..2823
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    2827..2937
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2827..2829,2836..2838,2878..2880)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2941..3048
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2941..2943,2950..2952,2992..2994)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3055..3165
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3055..3057,3064..3066,3106..3108)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3169..3279
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3169..3171,3178..3180,3220..3222)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3283..3393
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3283..3285,3292..3294,3334..3336)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3517..3627
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3517..3519,3526..3528,3571..3573)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3634..3744
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3634..3636,3643..3645,3685..3687)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3748..3858
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3748..3750,3757..3759,3799..3801)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3877..3972
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    3982..4083
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    4348..4455
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    4459..4569
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4459..4461,4468..4470,4510..4512)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4573..4683
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4573..4575,4582..4584,4624..4626)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4687..4803
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4687..4689,4696..4698,4744..4746)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4810..4917
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    5047..5148
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    5224..5334
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Domain found in Notch and Lin-12; Region: NL;
                     smart00004"
                     /db_xref="CDD:197463"
     misc_feature    5353..5457
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="LNR domain; Region: Notch; pfam00066"
                     /db_xref="CDD:459658"
     misc_feature    5491..5577
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="LNR domain; Region: Notch; pfam00066"
                     /db_xref="CDD:459658"
     misc_feature    5590..5754
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="NOTCH protein; Region: NOD; pfam06816"
                     /db_xref="CDD:462014"
     misc_feature    5833..5991
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="NOTCH protein; Region: NODP; pfam07684"
                     /db_xref="CDD:462229"
     misc_feature    5953..6216
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="juxtamembrane and transmembrane (JMTM) domain found
                     in Drosophila melanogaster neurogenic locus Notch protein
                     (dNotch) and similar proteins; Region: JMTM_dNotch;
                     cd21706"
                     /db_xref="CDD:411989"
     misc_feature    order(5956..5964,5971..5979,6037..6042,6046..6048,
                     6052..6078,6085..6090,6097..6105)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="putative polypeptide substrate binding site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:411989"
     misc_feature    6502..6642
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6604..7215
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="Ankyrin repeat [Signal transduction mechanisms];
                     Region: ANKYR; COG0666"
                     /db_xref="CDD:440430"
     misc_feature    6649..6741
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6748..6843
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    order(6847..6849,6853..6855,6865..6870,6877..6885,
                     6889..6894,6904..6906,6913..6915,6940..6942,6946..6948,
                     6952..6954,6964..6969,6976..6984,6988..6993,7003..7005,
                     7012..7014,7039..7041,7045..7047,7051..7053,7063..7068,
                     7075..7083,7087..7092,7102..7104,7111..7113,7138..7140)
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    6847..6942
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6946..7041
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    7045..7140
                     /gene="N"
                     /locus_tag="Dmel_CG3936"
                     /gene_synonym="1.1; 16-178; 16-55; anon-EST:Liang-1.12;
                     Ax; CG3936; Chp; clone 1.12; co; Co; CT13012; Dmel\CG3936;
                     dNotch; EG:140G11.1; EG:163A10.2; fa; l(1)3Cb; l(1)Ax;
                     l(1)N; nd; NECD; Nicd; NICD; notch; n[fah]; RICN; shd;
                     spl; swb"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
ORIGIN      
        1 acagatcgct tttttccagt ggacgaaacg gttgtgaaag cggacgagcg ttaggcagac
       61 gaacctggaa agcgcagagc acagttctca acatttattt tttttttgaa tgtgtgtgca
      121 acaacgcacg taaaatcgcg ctgccaacag gatatacaaa caaatcaatt acacagcaag
      181 caaatgcaat gaaatgaaaa ggatggcccc agcgggaaag ccgttcagca agagcaagga
      241 gtgcctgtcg cagggatagc aacgagagag cgacacagag agcgagagag agagagggag
      301 agaaacaagg attttcgaaa agtgtatcta cctcgagtcg cgcgtgtgtg agagtgagac
      361 gaaagccgag tgcaagaagc gcaagaggaa gagagcaata cgcaagcgtg cggcgtcggt
      421 ttgaatttga atttgtggct cgatcctcgc gaagagaaaa gcaagcaaaa gatacacgaa
      481 aagcgttctt tttttgccac ttttttttta tgtttcaaaa cggaaaatgt cgccgtcgtc
      541 gggagagtgc ctcctcttag tttatcaaat aaagctttaa agtctgaagt tcaaaactat
      601 aaaaaacaaa aaaaaaaaca aaaaaacaac aaacgcgcta aaacaaaaaa ttgcttaaac
      661 tactgagact agcatactaa acctaaactc gcagttaaac atatcctcaa agagagacca
      721 aagaggagcg ctaaagaaac cgagaagcga gtagaggtga aaaactggaa aagtggttaa
      781 ctggaaaact ggattacaat gcaatcgcag cgcagccgac gtcgcagtcg cgcaccaaac
      841 acttggattt gtttttggat taacaaaatg cacgccgttg cgtcgctgcc ggcgtcgctg
      901 cctctgctgc tgttgacgct ggcgtttgcg aatttgccaa acaccgttcg cggaactgat
      961 accgcgttgg tggccgcttc ctgcacaagt gtcggttgcc agaatggcgg cacatgcgtt
     1021 acacaactca atggcaaaac ctactgcgca tgcgattcgc actatgtcgg cgactactgt
     1081 gaacaccgca atccgtgcaa ttcgatgcgt tgccaaaatg gtggcacctg tcaggtgacc
     1141 tttcgcaacg gccgtccggg catctcgtgc aagtgtcctt tgggcttcga cgagtccctg
     1201 tgcgaaattg cggtaccgaa tgcctgcgat catgtgacct gcctcaatgg aggcacctgt
     1261 cagctaaaga cactggagga gtacacgtgt gcgtgtgcca atggctatac aggtgaacga
     1321 tgcgagacga agaatctgtg cgcaagttct ccctgccgga atggagccac ctgcaccgct
     1381 ttggccggaa gcagcagctt cacctgctcc tgtccgccgg gcttcaccgg tgacacctgt
     1441 tcctatgaca tcgaggagtg ccagtcgaat ccgtgcaaat acggcggcac atgtgtcaac
     1501 acccacggat cttaccagtg catgtgtccc acgggctaca cgggaaagga ttgcgacacc
     1561 aagtacaagc cctgctcgcc atcgccgtgc cagaatggcg gaatttgccg gtcgaacggt
     1621 ctgtcctacg agtgcaagtg ccccaaaggt ttcgagggca agaactgcga acagaactac
     1681 gacgattgcc tgggacatct ttgccagaac ggaggaacct gcatcgatgg catctcggac
     1741 tacacctgcc gctgtccacc gaacttcacg ggcagattct gccaggacga tgtggacgag
     1801 tgcgcccaac gggatcatcc ggtgtgccag aacggagcca cctgtacaaa cactcacgga
     1861 tcgtacagct gcatctgcgt gaatggctgg gcgggcttgg actgcagcaa caacacggat
     1921 gactgcaaac aggcggcctg tttctacgga gccacgtgca tcgatggcgt tggcagcttc
     1981 tattgccagt gtacgaaggg caagacgggt ctgttgtgcc acctggacga tgcctgtacc
     2041 tcgaatccct gccatgcgga cgccatttgt gacacgagtc cgataaacgg ctcctatgcc
     2101 tgttcctgtg ccaccggcta caagggcgtg gattgttcag aggacataga tgaatgcgat
     2161 cagggatcac cgtgcgaaca caatggcata tgcgtgaaca caccgggcag ctacagatgc
     2221 aattgctccc agggctttac gggtccgcgc tgcgagacga acatcaatga gtgcgaatcg
     2281 catccatgcc agaacgaggg atcttgcctg gatgatccgg gaacgttccg atgcgtctgt
     2341 atgccaggat tcacgggcac acagtgcgaa atcgacattg acgaatgcca atcgaatccc
     2401 tgcttgaacg atggaacttg ccacgacaag atcaatggct ttaaatgcag ttgtgccctg
     2461 ggctttacgg gcgcacgatg tcaaatcaat atagacgact gtcagtcgca accatgccgg
     2521 aatcgtggca tctgtcacga ctctatagcg ggctacagct gcgaatgtcc gccgggatat
     2581 acgggcacca gttgcgagat caatatcaac gattgcgatt cgaatccctg ccatcggggc
     2641 aagtgcatcg acgatgtgaa cagtttcaag tgcctctgtg atcccggcta cacgggctac
     2701 atatgccaga agcagatcaa cgaatgcgaa tcgaatccgt gccagttcga tggccattgc
     2761 caggatcgtg tgggcagcta ctattgtcag tgccaggcgg gaaccagtgg caagaattgc
     2821 gaggtcaatg tgaacgaatg ccacagtaat ccctgcaaca atggtgccac ctgcatcgat
     2881 ggcatcaatt cgtacaagtg ccagtgtgtg cccggtttta cgggtcagca ctgcgagaag
     2941 aacgtcgacg agtgcattag cagtccgtgt gccaacaatg gtgtctgcat agatcaggtg
     3001 aatggctaca agtgcgagtg tccgcgtgga ttctacgatg cccattgcct gagcgatgtg
     3061 gacgagtgcg catcgaatcc gtgcgtgaac gagggacgtt gcgaggatgg aatcaatgag
     3121 ttcatctgcc actgtccgcc aggatacacg ggcaagcgtt gtgagctgga catagacgag
     3181 tgcagcagca atccctgcca gcatggtggc acctgttatg ataagctcaa cgccttcagt
     3241 tgccaatgca tgccgggcta tacgggccaa aagtgcgaaa cgaatattga cgactgtgtg
     3301 accaatccgt gcggaaatgg aggcacctgc attgacaagg tcaacggcta caagtgcgtc
     3361 tgcaaagtgc ccttcacggg cagggattgt gaaagcaaaa tggatccctg cgccagcaat
     3421 cgttgcaaaa acgaggcgaa atgcacgcca agctcgaatt tcctggactt ctcctgcacc
     3481 tgcaaactgg gctatacggg tcgctattgc gatgaggaca tagacgaatg ctcactgagt
     3541 tcaccctgtc ggaatggagc tagctgtttg aatgttcccg gatcgtatag gtgcctctgc
     3601 accaagggct atgagggcag agattgcgcc atcaatacgg acgattgtgc ctcgtttccg
     3661 tgccagaacg gtggaacctg tctggatggg atcggtgact atagctgcct gtgcgtggat
     3721 ggcttcgatg gcaagcactg cgagacggac atcaatgagt gcttgagtca gccgtgccag
     3781 aatggagcca cgtgtagtca gtatgtgaat agctatacct gcacctgtcc actcggattc
     3841 tccggcatca attgtcagac gaacgatgag gattgcacgg agagctcgtg cttaaacggt
     3901 ggcagttgca tcgatggcat caatggctac aactgtagct gtttggctgg atattccggt
     3961 gccaattgtc agtacaagtt gaataagtgc gattcgaatc cctgtttgaa cggagccacc
     4021 tgccacgagc aaaacaacga gtacacatgc cattgtccca gtggctttac gggcaaacag
     4081 tgttccgaat atgtggattg gtgtggtcaa tcgccgtgcg agaatggagc gacctgtagc
     4141 cagatgaagc atcagtttag ctgcaaatgc tcggcaggat ggacgggtaa gctgtgcgat
     4201 gttcagacga tttcgtgtca ggatgcagca gatcggaagg gtctgagcct gcggcagttg
     4261 tgcaacaatg gcacgtgcaa ggattatgga aatagtcatg tgtgctactg ctcccaggga
     4321 tacgcgggta gctattgcca aaaggagatc gacgagtgcc aatcgcaacc gtgccagaat
     4381 ggtggaacgt gccgagatct catcggagcc tacgaatgcc agtgtcgcca gggatttcag
     4441 ggtcagaatt gcgaactgaa catcgatgac tgtgcaccga atccctgcca gaatggcggc
     4501 acttgccacg accgtgtgat gaactttagc tgcagctgtc caccgggaac gatgggcatc
     4561 atatgcgaga tcaacaagga tgattgcaaa ccgggagcat gccacaacaa cggcagctgc
     4621 atcgatcgcg ttggaggctt cgagtgcgtc tgtcagcccg gttttgtggg tgcccgctgc
     4681 gagggcgaca tcaacgagtg cctaagcaat ccctgttcga atgccggcac actggactgc
     4741 gtccagttgg tcaataacta tcactgcaac tgtcgacctg gacatatggg tcggcactgt
     4801 gagcacaagg tggacttttg tgcccagagt ccgtgccaga atggtggcaa ttgtaatatc
     4861 cgacagagtg gccaccactg catctgtaat aatggattct acggtaagaa ctgtgagctg
     4921 agtggtcagg attgtgattc gaatccctgc cgtgtgggta actgtgttgt cgcggacgag
     4981 ggattcggct atagatgcga gtgtccaagg ggcacactgg gtgagcactg cgagattgat
     5041 acgctagacg aatgttcgcc gaatccctgt gcccagggag ctgcctgcga ggatttgctc
     5101 ggtgattacg aatgcctctg tccgagcaaa tggaaaggca aacgctgcga tatctatgat
     5161 gccaactatc cgggatggaa tggcggttcg ggatccggaa atgatcgcta tgccgctgat
     5221 ttggagcaac aacgtgccat gtgcgataag cgaggttgca ccgaaaagca gggcaacggc
     5281 atttgcgatt ccgattgcaa tacgtatgcc tgcaactttg atggaaacga ttgctcactg
     5341 ggcatcaatc cgtgggccaa ttgcacggcc aacgagtgct ggaacaaatt caagaacggc
     5401 aaatgcaacg aggagtgcaa caatgctgcc tgccactacg atggtcacga ttgcgaacgg
     5461 aaattgaaga gttgcgatag ccttttcgat gcctactgcc agaagcatta cggcgatggt
     5521 ttctgcgact atggatgcaa taatgcggaa tgcagttggg acggactcga ctgtgagaac
     5581 aagacccagt caccggtttt ggccgagggt gccatgtccg tggtgatgct aatgaatgtg
     5641 gaggcattcc gcgagattca ggctcagttc cttaggaata tgagccacat gctgcggaca
     5701 acggtgcggt tgaagaagga cgctcttggt catgacatca ttatcaattg gaaggacaat
     5761 gtgcgcgtgc cggagatcga ggatacggac tttgcgagaa aaaacaagat tctgtacacc
     5821 caacaggtcc atcagacggg cattcaaatc tatttggaga ttgacaatcg caaatgcacc
     5881 gaatgcttta cgcacgccgt tgaggcagcc gaatttctgg ctgccacggc ggccaaacat
     5941 cagctgcgga acgattttca gatacacagt gttaggggca tcaagaatcc cggcgatgag
     6001 gacaatggtg agccgccggc gaatgtgaaa tacgtaatta ctggcattat actggtcatc
     6061 attgcattgg ccttctttgg catggtcttg agtacgcaaa gaaagcgggc acatggcgtc
     6121 acctggttcc cggagggatt ccgtgcaccg gcggcggtta tgtcgcgacg tcgacgtgat
     6181 ccacacggcc aagagatgcg gaatctcaac aagcaggtgg ccatgcaatc gcagggtgtt
     6241 ggccagccag gtgctcattg gtccgacgat gaatcggata tgccgttgcc caagcgacag
     6301 cgcagtgatc ccgtttccgg tgtcggtctg ggcaacaatg gtggctatgc cagtgatcat
     6361 acaatggtca gcgaatatga ggaggctgat cagcgggtct ggtcgcaggc ccatctggat
     6421 gtggtcgatg tgcgggccat aatgacaccg ccggcgcatc aggatggtgg caagcacgat
     6481 gtggatgcac gtggaccttg cggactgact ccgctaatga ttgctgccgt acgaggcggt
     6541 ggcctggaca ctggcgagga tatcgagaac aatgaggaca gtactgccca ggtgatatcg
     6601 gatctattgg cacagggagc cgagttaaat gccacaatgg ataaaacggg cgagacatca
     6661 ttgcatttgg cagcacgttt tgctcgagca gatgccgcca agagattatt ggacgccggt
     6721 gcggatgcca attgtcagga taacacgggc aggacaccgc tgcacgctgc tgtggccgcc
     6781 gatgccatgg gtgtatttca gatattgctt aggaataggg ctaccaatct aaatgctaga
     6841 atgcatgacg gcacaacgcc actaatactg gccgctcgtc tagccatcga gggcatggtg
     6901 gaggatttga tcacagccga tgcggatatt aatgcagcgg ataattccgg caagaccgct
     6961 ctccattggg cagcggcggt taacaatacc gaagcggtga acattctgct aatgcatcat
     7021 gccaatcgcg atgcccagga cgataaggat gagacaccgc tgtttctggc cgcacgcgag
     7081 ggtagctatg aggcgtgcaa ggcgctgttg gataattttg ccaatcgcga gattaccgat
     7141 cacatggatc gattgccacg cgatgtggcc agcgagcgac tgcatcacga tattgtcagg
     7201 ctgctggacg agcatgtgcc gcgatctccg caaatgctga gcatgacacc gcaggcaatg
     7261 atcggatccc cgccgccggg tcaacagcag ccgcagttga tcacacagcc gacggtcatt
     7321 tccgccggaa atggtggcaa caatggcaat ggcaatgcca gcggaaagca gagcaaccaa
     7381 acggccaaac agaaggcggc caagaaggcc aaactaatcg agggcagtcc ggacaatggg
     7441 ctggatgcca cgggcagttt gcgacgcaag gcaagttcaa aaaagacaag tgcggcctca
     7501 aaaaaggccg ccaacttgaa tggcctaaat ccgggccagc tgacgggggg agtgtcgggc
     7561 gtgccgggtg taccgccaac gaattcagcg gcacaagcag ctgcagcggc agcggcagcc
     7621 gtggcggcca tgtcccacga actggagggt tcgccggtgg gcgtgggcat gggcgggaat
     7681 ctgcccagtc cgtacgacac cagttcgatg tactcgaatg cgatggccgc accgctggcg
     7741 aacggcaatc cgaacacggg cgccaagcag ccgccgagct atgaggattg catcaagaat
     7801 gcgcaatcga tgcaatcgct gcagggcaat ggtctggata tgatcaagct ggataattat
     7861 gcctactcga tgggctcgcc atttcagcag gagctgctca atggccaagg actcgggatg
     7921 aatggtaatg gccagcgaaa tggagtcggt cccggcgttc tgcccggcgg cctatgcgga
     7981 atgggcggtc tgagtggagc cggcaatgga aatagccacg aacagggact gagtccgccg
     8041 tactcgaatc agtcgccgcc gcattcggtg cagagcagcc tggcgctatc gccccacgcc
     8101 tacttgggct cgccatcgcc ggccaagtcg cgacccagtc tacccacctc gcccacccac
     8161 attcaggcga tgaggcatgc cacacagcag aagcaattcg gtggcagtaa tctgaatagt
     8221 ttgctgggcg gtgccaatgg cgggggcgtg gtcggcggag gaggaggtgg tggtggtggt
     8281 gttggccagg ggccacaaaa ctcacccgta agcttgggaa tcatctcgcc gacgggcagc
     8341 gatatgggca tcatgctcgc cccgccccaa tcctcgaaga atagtgcaat aatgcaaacg
     8401 atatcacccc agcaacagca gcagcagcag caacagcaac agcagcaaca tcagcagcag
     8461 caacagcagc agcaacagca gcagcagcaa cagcagcagc aactcggagg cctggagttc
     8521 ggttcagcgg gcttggacct gaatggattt tgtggatctc cggactcatt tcactcgggt
     8581 caaatgaatc cgccctcgat acaaagttca atgtccggct catcgccgtc gaccaatatg
     8641 ttgtcgccgt cgtcgcagca caatcagcag gccttctacc agtacctaac gccttcgagc
     8701 caacattccg gcggccatac gccgcagcat ttggtccaaa cgttggatag ctatccgacg
     8761 ccctcgccgg agtcacctgg ccactggtcc tcctcgtcgc cgcgatcgaa ttccgattgg
     8821 agcgagggcg ttcagtcgcc ggcggcaaat aatctttaca tatccggtgg ccatcaggct
     8881 aacaagggtt ccgaggccat ctacatttga ccgtgatctg gatgatttgg tatgttgaat
     8941 atcgcgcaag gataattgga tggcttgcca aggataacag caaaagggga ctcttaaaga
     9001 gtccgcggct aagttcgatc taaaatatgc tatatattgt aattctctaa tctctacgga
     9061 ttatgtattt tttccaacga ctcttttttt ttttttttga gtgtgtctat aagttttaga
     9121 tgttagtgcg aaatacgcaa ttctagcgga agaagcgtca taaattgtag taacttaaat
     9181 tttatttaat gcttgttgta cagtgcgcgc cgatcgcata tatatatata tatatagata
     9241 ttgatataga tatatgtata tctactcata gatataccag ttaagagctc gtcttgtggc
     9301 gcattttatt ttattgtcgt aacgtcatcg tagcttccag taaaaaaaaa aacaaaaaac
     9361 aaaagaatca acataaaaag atgagcaact aaacttagcg caaattctga ttggatcgat
     9421 taaacgtttg tgggacaatt tgtagttgta agtgaccatt atatcactag gccataagac
     9481 tacgctaagt tttttttatc gaattctaca ttattaatta tggccccaca tgctatatat
     9541 aaatacataa atttcgtagt tctgtaggtt ttgaaactga agtgcttata taaacaaaat
     9601 tgttagaccg t