Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001258578 4366 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_001258578 VERSION NM_001258578.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 4366) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 4366) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 4366) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 4366) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 4366) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 4366) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 4366) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 4366) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 4366) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 4366) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 4366) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 4366) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 4366) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 4366) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 4366) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 4366) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 4366) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 4366) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..4366 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..4366 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="kin of irre" /map="3B4-3C7" /db_xref="FLYBASE:FBgn0028369" /db_xref="GeneID:31292" CDS 1130..4000 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="CG3653 gene product from transcript CG3653-RE; CG3653-PE; kirre-PE; dumbfounded; Dumbfounded/Kirre; Kin of irregular-chiasm-C; kin-of-irreC; kin of irreC; Kin-of-irre" /codon_start=1 /product="kin of irre, isoform E" /protein_id="NP_001245507.1" /db_xref="FLYBASE:FBpp0301280" /db_xref="GeneID:31292" /db_xref="FLYBASE:FBgn0028369" /translation="MKRMRSSRLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHH GDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLP CRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQ CQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA EITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR TYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND ELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVE ADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKAVVNG FPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINM SSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPG NIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKS ELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGG DRYNRQCHIKNLKNQQETAYKGSPQANGYAHYFEYALDYSPPGGEGAAVVVGSGGVGK LKNGGMNSATLPHSAAATVNGGGAGNGGGASLPRNQRHEIQQSQQSNGFLGQPLLQNG IDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANGGLKH FVGGAVITTSPVGNVNINGGGGGGSTPSGGGGVGVGVAAGGSVSGSSSNLTASSNTLA ATPLAGGGVGNSGQCAQSPSGQFILSNNGKGHTQKGPLATHV" misc_feature 1391..1675 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1424..1438 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409552" misc_feature 1559..1573 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409552" misc_feature 1601..1618 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409552" misc_feature 1694..1966 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="CD80-like C2-set immunoglobulin domain; Region: C2-set_2; pfam08205" /db_xref="CDD:400489" misc_feature 1784..1798 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409416" misc_feature 1880..1894 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409416" misc_feature 1922..1939 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409416" misc_feature 1967..1978 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409416" misc_feature 2048..2266 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig_2; pfam13895" /db_xref="CDD:464026" misc_feature 2273..2515 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2324..2338 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2363..2380 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2450..2467 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2492..2503 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2525..2812 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 2573..2587 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 2615..2629 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2714..2728 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2756..2773 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2795..2806 /gene="kirre" /locus_tag="Dmel_CG3653" /gene_synonym="CG3653; CT12279; Dmel\CG3653; dNeph; duf; Duf; DUF; duf/kirre; Duf/Kirre; DUF/KIRRE; EG:163A10.1; Kirre; Neph1; RH09239" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" ORIGIN 1 tatgcgcatt gtgatgcgaa gcatttgcgc gtttttcttc ctaaattcgc tgtaattttg 61 cgttttcaat ggcgcgcgaa atatgtttct ttacttaaag tgatatgaaa atgatcgtct 121 cgcaaattat agatgcgata aagtcaaatg aaatgaaaaa tgaatacaac atcgagattg 181 aactgctaac ggaaaacttt acctaagaag tagaacagta gaattgagga tacatctgag 241 aatcagcgag gacgggaaca ttctgcggtc agaagttgtc agttgataaa aatgcccgaa 301 cagagccaac gatagtcgac cgaaatccac tttggctaaa tgtaaatatt aaatttgcgc 361 ataaaaataa tacggcagaa aggagataga gatagcccgg atagcaaact aaagtgaatt 421 cacaaaggaa aaggagagcc ataaaaaagc tgactgcggc aggactatga agtgccagtg 481 gaggctaagg tcctagactc gaactctcaa ttgacgcgtc ctcgaagttg ccgccagatg 541 cagaagctga gaataccaag aaatccaaga aatccgagaa atccaacaga tctgagagct 601 gcgtccgtcg gtcagcaaac tttgggctct gccttttggc tcttctaatt aagatgaatt 661 aagcaaaatc atttcgatta gaaaaacgga ggagccgcag caagcaaaaa gcgcacagcg 721 atggtgaaac agcgaaagaa actaactgtt ctttggggcg tttgatgatg agccgatgga 781 tgggatgacg atggccgcaa aaaaaaaggg cagggaaaag aaacaaatgc tgagagatgc 841 taaatgacga tgagggcccg tgtaattgct gttaactctg gggcataata actttattag 901 gaagttcgtc ttgaacttgc agcagccgcc gcaattgggg gcaaatttaa gtgcccccac 961 cccccctcac cctctccgca cacgctcaca aaaaaaaaaa aaggaaaacg gaaatctagc 1021 ccatggtaac tcgaatttga ttgaagattc cgttgtgaaa tttggtgtga actccatttg 1081 cgtggtcatg tggcatcgta gctgctgagt tagcaatttg ccgctgaaaa tgaagcgaat 1141 gcgcagcagt cgcctcctgg tgctgccatt gatccttgtg ctgatcctga cgctgctcct 1201 ccaaccgatt gccgtccacg ccaaatcgaa gaagaacaag tccagccaga gctcgcacca 1261 cggtgactca tcctcctcct cctcatcctc atcctcgtcg agtggctcct catcggcggc 1321 agcatcgtca gcgaatgatg aaagcaaacc gaagggcggc gacaatggtg gtcagcactt 1381 tgccatggag ccgcaggatc agacggccgt cgttggttca cgcgtaacgt tgccatgccg 1441 ggttatggag aaagttggtg ccctgcaatg gaccaaagat gacttcggtc tgggccaaca 1501 tcgcaatttg agcggcttcg aacgctactc gatggtcggc agcgatgagg agggtgactt 1561 ctcattggac atttatccgc taatgctgga cgacgatgcc aagtatcagt gtcaagtggg 1621 tccaggtcca cagggcgagc agggtattcg ttcgcgattc gccaagctaa ccgttctcgt 1681 tccgcccgag gcgccgaaaa tcacgcaagg tgactatctg gtgaccaccg aagatcgtga 1741 aatcgaattg gagtgcgtgt cgcagggcgg caagcccgca gccgaaatca cttggattga 1801 cggactgggc aatgtcctaa ccaagggtat tgaatatgta aaggaaccgc tggccgattc 1861 gcgtcgaatt acagccagat cgatactgaa attggcgccc aagaaggagc atcacaacac 1921 aacgttcacg tgccaggcgc aaaataccgc cgatcgaacc tatagatcgg ccaaactgct 1981 gctcgaggtg aaatatgcgc ccaaggtcat cgtttcggtt gtgggtggtg cattggctgg 2041 tggcaaaatt cccgaaggcg ccgaggtaat actaagctgt caggccgacg ccaatccgca 2101 tgagctcagc tatcgttggt tcatcaacga tgagctaatg accggagact ttaccactaa 2161 gatgatcatt cacaatgttt cgaggcaata tcacgatgcc atagtcaagt gcgaggtggt 2221 taatgcggtg ggcaagagcg aacagagcaa gaaactggac attagttttg gtccagtttt 2281 tcgccagcgt cccgttagcg tggaagccga tctgggcgcc accgttagca tgcgttgcga 2341 tgtggctggc aatccggagc ccgaaatcga atggatcagc gagaactccg atcaggttgt 2401 tggcgttgca gcggaactga aattgaaagt gagcagcgaa acggcaggtc gctacttttg 2461 caaggctgtg gtcaatggat ttcccgaaat cggtgccgag gcaacgctgt acgtgaaaag 2521 ggcaccgatt atcacatcgc acaaggtgca atttggcgga gttggtggtc gcgttaagat 2581 cgattgtttg gcctttagca taccgaaggc ggagcatata ctctggtcgt tcgagggcaa 2641 gattatcaat atgagcagcg ccgatccgga tatatatata ttcgaggagc atcatttgcc 2701 ggagggcgtg cgagcggcct tgattattcg cgatagcaag gccacacatt ttggcaaata 2761 caattgtaca gtgatgaatt cgtatggcgg tgattcgttg gttataacat tgctacgcga 2821 accgggcaac atacccgttc tgctggtcgt tatgggctcc atgttttgcg tggccatcat 2881 tctgatgatc gtaatgatta ttatcgtgta ccgcaagcga cgcagtcgca agaagcccat 2941 gccagcggat gtaataccgg aggcatcacg cggcggtgat aagctaaacg aattgaagag 3001 cgagctacgc tcgaaggcct atgatgtgga atactcggag gcgggcggcg atggactggc 3061 cattaatctt acccaatcac cgatgcccga tgttcagatg aagggcgcca cacttggtgt 3121 gccactagcc ggacccgtta agttcgatga gcgcttttcg ggcgatttcg gtggcgatcg 3181 ttacaatcga cagtgtcaca ttaagaatct aaagaatcaa caggagaccg cctacaaggg 3241 tagtccacag gccaatggct atgcccatta ctttgaatat gccctcgact atagtccgcc 3301 gggcggtgag ggtgctgccg tggtggtggg cagcggcggc gttggcaagt tgaagaacgg 3361 tggcatgaac tcggccacgt tgccccactc ggcggctgcc accgtgaatg ggggcggtgc 3421 tggcaatggg ggcggtgcca gtttgccgcg caatcagcgg cacgagattc aacagtcgca 3481 gcaatcaaac ggatttctcg gacaaccgct gctgcagaat ggcatcgata gccgctttag 3541 cgccatctat ggtaatccct atttaaggac gaactcctcg ctactgccgc ccctgccgcc 3601 gccgagcacc gccaatccgg cggccacgcc cgccccgccc ccctatcatg ccgctcgcca 3661 cggccacgcc catcacgcca acggcggact caagcatttt gtgggcggcg ctgtgatcac 3721 cacaagtccc gtgggaaatg tgaacattaa tggcggcgga ggcggtggct cgacgcccag 3781 cggtggcggc ggcgtgggcg tgggcgtggc agctggtggc agcgtcagcg gcagcagttc 3841 caacttgacc gccagcagca atacactggc ggccacgccc ctagcgggcg gcggcgtcgg 3901 caacagcggc cagtgcgccc agagtccgtc cggtcagttt atattgtcga ataatggcaa 3961 aggacacacg cagaaaggac ctctggccac tcatgtttaa actacaaaga aggatataca 4021 cacacatctt tctatattat atatatatat atagaaggca ctagcataac tcataaatgt 4081 atttaaaagc cgaacatcta gtgtgtaaac tttttttttt tgtccatcga tattagcgta 4141 atattctgat tcaagcggtg tgctgaactt tcgaaaagat cttgggttgt aaatgcaact 4201 gacttggatt tatctgatat ggctgaaatt cgagcactaa gaatgtgact gctttcgttt 4261 gtaaatttgt aacgtacagc tcccaaaaac aaaaaaaaag agaaaagagt tcaacacacc 4321 cttgagtaaa aaaaagaaat gtgtataaaa acgaaaaaca aaacac