Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001169235 5064 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_001169235 VERSION NM_001169235.1 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 5064) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 5064) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 5064) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 5064) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 5064) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 5064) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 5064) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 5064) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 5064) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 5064) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 5064) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 5064) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 5064) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 5064) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 5064) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 5064) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 5064) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 5064) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5064 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..5064 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Neuroglian" /map="7F2-7F4" /db_xref="FLYBASE:FBgn0264975" /db_xref="GeneID:31792" CDS 273..3992 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="CG1634 gene product from transcript CG1634-RF; CG1634-PF; Nrg-PF; icebox; central brain deranged; neuroglian; lethal (1) G0488; female sterile(1)M72" /codon_start=1 /product="neuroglian, isoform F" /protein_id="NP_001162706.1" /db_xref="FLYBASE:FBpp0290978" /db_xref="GeneID:31792" /db_xref="FLYBASE:FBgn0264975" /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL" misc_feature 357..656 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 435..449 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 474..488 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 552..566 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 594..611 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 636..647 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 681..920 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 723..737 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 765..779 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 846..860 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 897..914 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1023..1268 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 1062..1076 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1101..1115 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1185..1199 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1212..1229 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1254..1265 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1287..1553 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 1287..1298 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 1314..1325 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 1338..1361 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1377..1394 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1401..1409 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 1431..1445 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 1449..1463 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1488..1514 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1521..1553 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 1608..1823 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1617..1631 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1656..1670 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1719..1733 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1761..1778 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1800..1811 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1833..2117 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1884..1898 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1929..1943 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2001..2015 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2043..2060 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2082..2093 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2109..2393 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature 2319..>3425 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2358..2363,2367..2372) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3021..3023,3231..3233,3276..3278) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3024..3293 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3393..3605 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(3582..3587,3591..3596) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3735..3983 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" ORIGIN 1 gcgaatatat atcgttattt ggtgcaacag cagaaagtaa taaaagctcg gctcgcatgc 61 aattttcatt agtgggaaaa ttgtttgata tttaagaggc aaccgaggaa taaacggaat 121 caacagcagc agacacacac acacacattc caagccaaat taataataga aaagaaaaac 181 aaaaaaaaaa aaacagcaac cagaaaacca ataaaagttt aaaccaaaac gaaacacact 241 cgagggggcg agcggagagc caaacgacca aaatgtggcg gcagtcaacg atactggccg 301 cgttactagt ggctcttttg tgtgcgggca gtgcagaaag caaaggcaat cgcccaccaa 361 gaatcaccaa acaaccggca cccggagaat tgctcttcaa agtggcgcaa cagaataagg 421 aaagtgacaa tccattcata atcgagtgcg aagccgatgg acaacccgag ccagaatata 481 gttggatcaa gaacggcaag aagttcgatt ggcaggcgta cgataaccgc atgctgcggc 541 agccaggacg tggcaccctg gtgatcacca tacccaagga cgaggatcgc ggccactatc 601 agtgctttgc gtccaatgaa ttcggaacgg ccacctcgaa ctcagtatat gtgcgtaagg 661 ccgagctgaa tgccttcaag gatgaggcgg ccaagacact ggaggccgtc gagggtgagc 721 cctttatgct gaaatgtgcc gcacccgatg gttttcccag tccgacagtc aactggatga 781 tccaggagtc catcgatggc agcatcaagt cgatcaacaa ctctcgcatg accctcgatc 841 ctgagggtaa tctctggttc tcgaatgtta cccgtgagga tgccagctcc gatttctact 901 atgcctgctc ggccacctcg gtgtttcgca gtgaatacaa gattggcaac aaggtgctcc 961 tcgatgtcaa acagatgggc gttagtgcct cgcagaacaa gcatccgccc gtgcgtcaat 1021 atgtttcccg tcgccagtcc ttggcgttgc gtggcaagcg aatggaactg ttttgcatct 1081 acggtggaac accgctgccg cagaccgtgt ggagcaagga tggccagcgt atacagtgga 1141 gcgatcgaat aacgcaagga cactatggca aatcactggt cattcggcag acaaatttcg 1201 atgatgccgg cacatacacc tgcgacgtgt ccaacggtgt gggcaatgcc caatccttct 1261 ccatcattct gaatgttaac tccgtgccgt actttaccaa agaacctgaa atcgccaccg 1321 ccgccgaaga cgaagaggtt gtcttcgagt gtcgcgctgc tggtgtacca gagcccaaga 1381 tcagttggat tcacaatggt aagcccatcg agcagagcac cccgaatccc cgacgaacgg 1441 ttacggacaa cacaattcgc attatcaatc tggttaaggg cgatactggt aactacggtt 1501 gcaacgccac caattcgctg ggatatgtgt ataaggatgt ctatctaaat gtccaggctg 1561 agccgccaac gatttccgaa gctccagcag ctgtatccac tgtcgatgga aggaatgtga 1621 ccattaagtg cagggttaac ggttccccca agcctctggt taaatggcta agggccagca 1681 actggctgac cggaggtcgt tacaatgtcc aagctaacgg tgacctggag atccaagatg 1741 tgacattctc ggatgccggc aaatacacat gctatgcgca gaacaagttt ggtgaaattc 1801 aagccgatgg ttcgctggtg gtcaaggagc atacgagaat tacccaagag ccgcaaaact 1861 acgaggtggc cgccggacaa tcggccacgt tccgctgtaa cgaggcccac gacgatacgc 1921 tggagattga gatcgattgg tggaaggatg gccagtccat tgactttgag gcccagccgc 1981 gattcgtgaa gaccaatgat aattccctga cgattgccaa gacaatggag ttggattctg 2041 gcgaatatac gtgcgtggcc cggacgcgtt tggatgaggc aacggccagg gcgaatttga 2101 ttgtccagga tgtgccgaat gcaccaaaac tgaccggcat cacctgccag gccgacaagg 2161 ccgagatcca ctgggaacag cagggtgaca atcgttcgcc cattctgcac tacaccattc 2221 agttcaatac atcgttcacg cccgcctcct gggatgccgc ctacgagaag gtgcccaaca 2281 cggactcctc gttcgtcgtc cagatgtcac cgtgggccaa ctatacgttc cgtgtgattg 2341 ccttcaacaa gatcggagcc tcgccgccgt cggcgcacag cgatagctgc accacccagc 2401 cggatgtgcc cttcaagaat cccgacaatg tcgttggcca gggcactgag cccaacaatc 2461 tggtcatctc gtggactccc atgcccgaaa tcgagcacaa tgcccccaat ttccattatt 2521 atgttagctg gaaacgcgat attcctgccg ctgcgtggga aaacaataac atattcgact 2581 ggcgacagaa caacattgtg attgccgatc aaccgacttt cgtgaaatac ctgatcaagg 2641 tggtggccat caacgatagg ggtgagtcca atgtggccgc cgaggaggtg gttggctact 2701 ctggcgaaga tcgtcccctg gatgcgccca ccaacttcac aatgaggcaa atcacatcat 2761 cgaccagtgg ctacatggcc tggacgccgg taagtgagga atcggtgcgc ggacacttca 2821 agggctacaa aatccaaacg tggacggaga acgagggcga ggagggtctg cgggagatcc 2881 atgtgaaggg tgatacccac aacgctctgg tcacacaatt caagcccgat tcaaagaact 2941 atgcccgcat tttggcttac aatggacgct tcaatggccc acccagtgcc gtcatcgact 3001 tcgatactcc ggagggtgta ccatcgccgg ttcagggact ggatgcctat cctctgggct 3061 cctcggcctt catgctccac tggaagaagc cgctgtatcc caatggcaag ctcactggct 3121 acaagatcta ctacgaggag gttaaggaga gctatgtggg cgagcgacgc gaatacgatc 3181 cacacatcac cgatcccagg gtcacacgca tgaagatggc cggcctgaag cccaactcca 3241 agtaccgcat ctccatcact gccaccacga aaatgggcga gggatctgaa cactatatcg 3301 aaaagaccac gctcaaggat gccgtcaatg tggcccctgc cacgccatct ttctcctggg 3361 agcaactgcc atccgacaat ggactagcca agttccgcat caactggctg ccaagtaccg 3421 agggtcatcc aggcactcac ttctttacga tgcacaggat caagggcgaa acccaatgga 3481 tacgcgagaa tgaggaaaag aactccgatt accaggaggt cggtggctta gatccggaga 3541 ccgcctacga gttccgcgtg gtgtccgtgg atggccactt taacacggag agtgccacgc 3601 aggagatcga cacgaacacc gttgagggac caataatggt ggccaacgag acggtggcca 3661 atgccggatg gttcattggc atgatgctgg ccctggcctt catcatcatc ctcttcatca 3721 tcatctgcat tatccgacgc aatcggggcg gaaagtacga tgtccacgat cgggagctgg 3781 ccaacggccg gcgggattat cccgaagagg gcggattcca cgagtactcg caaccgttgg 3841 ataacaagag cgctggtcgc caatccgtga gttcagcgaa caaaccgggc gtggaaagcg 3901 atactgattc gatggccgaa tacggtgatg gcgatacagg catgaatgaa gatggatcct 3961 ttattggcca atatggacgc aaaggacttt gatttaatta gtaagcagcg caccgcaaca 4021 gcaactcaaa aataatatcg aaaccgagcc cttaacccca aaaatcaaaa aatcaacaag 4081 accaaacacc atcacagcag aaaaatgaaa aaattaatga aaataatagt agcctacatt 4141 ttattcgact ataagtgcaa acaccacgac taatttaaag tatatataaa aatagaggtt 4201 ttatatataa ctattaaaat cttaaaatgt gtaaaaaaaa aaacaaacaa acaaaatgaa 4261 tgcaaatcaa tactgccaaa caacttgaac aacaagcaac acaacagcaa aaacaacaac 4321 aacgagaatg cagcaaaaag gctattatca aaataaaagt cttcatatcg gaagaagtag 4381 ttatcgaaaa agaaatgcat gcgaatcaaa ccgaattatg aaaaaaaaaa tcatataatt 4441 ttctggacgt tatggggatg atgcgtgtaa ttttttttta ttttaaagaa atttaagaaa 4501 ctatgtatga ggaaaataat gaagctcgct tatgaaatct ctatattgcg cacatgtcta 4561 cctgtcccac tctgtccccg gtactctgta tatctttgtc ccgctctctc ccttctctac 4621 ttgtaatgca tatatattta taaatataaa gcgtaaataa gttataattt agtaattttt 4681 ttataaagca acagcacttg aatgtcaaat ctccgtttta gattggtcgt aaatcgaaat 4741 gaaactctct tttagcttac atgtttacta ctttatttaa gcctattgtg tgtattttgt 4801 ttttatttca ttattttatt ttttttagtt cgtgtaatga ctttgaattt ttttgctttg 4861 aaattgaaac aatgttttag tatagcctcg tgtttgtttt ccgggaagag caacaaaaat 4921 gaagtgtatt ttttcagtgt atttaatatt aaagaatgaa tgacgaaaac atcataatta 4981 tatgaaaata taattttttt tacatatgtt gatgtacgtt cgcatataaa tttagaaaga 5041 aaacaaataa aataaagaaa accg