Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001169234 7386 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_001169234 VERSION NM_001169234.3 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 7386) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 7386) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 7386) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 7386) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 7386) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 7386) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 7386) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 7386) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 7386) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 7386) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 7386) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 7386) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 7386) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 7386) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 7386) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 7386) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 7386) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 7386) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On Jan 16, 2013 this sequence version replaced NM_001169234.2. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..7386 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..7386 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Neuroglian" /map="7F2-7F4" /db_xref="FLYBASE:FBgn0264975" /db_xref="GeneID:31792" CDS 299..4207 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="CG1634 gene product from transcript CG1634-RE; CG1634-PE; Nrg-PE; icebox; central brain deranged; neuroglian; lethal (1) G0488; female sterile(1)M72" /codon_start=1 /product="neuroglian, isoform E" /protein_id="NP_001162705.1" /db_xref="FLYBASE:FBpp0290977" /db_xref="GeneID:31792" /db_xref="FLYBASE:FBgn0264975" /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK PGVESDTDSMAEYGDGDTGQFTEDGSFIGQYVPGKLQPPVSPQPLNNSAAAHQAAPTA GGSGAAGSAAAAGASGGASSAGGAAASNGGAAAGAVATYV" misc_feature 383..682 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 461..475 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 500..514 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 578..592 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 620..637 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 662..673 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 707..946 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 749..763 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 791..805 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 872..886 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 923..940 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1049..1294 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 1088..1102 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1127..1141 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1211..1225 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1238..1255 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1280..1291 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1313..1579 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 1313..1324 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 1340..1351 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 1364..1387 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1403..1420 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1427..1435 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 1457..1471 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 1475..1489 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1514..1540 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1547..1579 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 1634..1849 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1643..1657 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1682..1696 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1745..1759 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1787..1804 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1826..1837 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1859..2143 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1910..1924 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1955..1969 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 2027..2041 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2069..2086 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2108..2119 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2135..2419 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature 2345..>3451 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2384..2389,2393..2398) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2747..3013 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(2999..3004,3008..3013) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3047..3049,3257..3259,3302..3304) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3050..3319 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3419..3631 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(3608..3613,3617..3622) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3761..4015 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" ORIGIN 1 gcagttcctc tccgcattcg aaaagaaaat atccgcgctg ctggttgttg caacagcaga 61 aagtaataaa agctcggctc gcatgcaatt ttcattagtg ggaaaattgt ttgatattta 121 agaggcaacc gaggaataaa cggaatcaac agcagcagac acacacacac acattccaag 181 ccaaattaat aatagaaaag aaaaacaaaa aaaaaaaaac agcaaccaga aaaccaataa 241 aagtttaaac caaaacgaaa cacactcgag ggggcgagcg gagagccaaa cgaccaaaat 301 gtggcggcag tcaacgatac tggccgcgtt actagtggct cttttgtgtg cgggcagtgc 361 agaaagcaaa ggcaatcgcc caccaagaat caccaaacaa ccggcacccg gagaattgct 421 cttcaaagtg gcgcaacaga ataaggaaag tgacaatcca ttcataatcg agtgcgaagc 481 cgatggacaa cccgagccag aatatagttg gatcaagaac ggcaagaagt tcgattggca 541 ggcgtacgat aaccgcatgc tgcggcagcc aggacgtggc accctggtga tcaccatacc 601 caaggacgag gatcgcggcc actatcagtg ctttgcgtcc aatgaattcg gaacggccac 661 ctcgaactca gtatatgtgc gtaaggccga gctgaatgcc ttcaaggatg aggcggccaa 721 gacactggag gccgtcgagg gtgagccctt tatgctgaaa tgtgccgcac ccgatggttt 781 tcccagtccg acagtcaact ggatgatcca ggagtccatc gatggcagca tcaagtcgat 841 caacaactct cgcatgaccc tcgatcctga gggtaatctc tggttctcga atgttacccg 901 tgaggatgcc agctccgatt tctactatgc ctgctcggcc acctcggtgt ttcgcagtga 961 atacaagatt ggcaacaagg tgctcctcga tgtcaaacag atgggcgtta gtgcctcgca 1021 gaacaagcat ccgcccgtgc gtcaatatgt ttcccgtcgc cagtccttgg cgttgcgtgg 1081 caagcgaatg gaactgtttt gcatctacgg tggaacaccg ctgccgcaga ccgtgtggag 1141 caaggatggc cagcgtatac agtggagcga tcgaataacg caaggacact atggcaaatc 1201 actggtcatt cggcagacaa atttcgatga tgccggcaca tacacctgcg acgtgtccaa 1261 cggtgtgggc aatgcccaat ccttctccat cattctgaat gttaactccg tgccgtactt 1321 taccaaagaa cctgaaatcg ccaccgccgc cgaagacgaa gaggttgtct tcgagtgtcg 1381 cgctgctggt gtaccagagc ccaagatcag ttggattcac aatggtaagc ccatcgagca 1441 gagcaccccg aatccccgac gaacggttac ggacaacaca attcgcatta tcaatctggt 1501 taagggcgat actggtaact acggttgcaa cgccaccaat tcgctgggat atgtgtataa 1561 ggatgtctat ctaaatgtcc aggctgagcc gccaacgatt tccgaagctc cagcagctgt 1621 atccactgtc gatggaagga atgtgaccat taagtgcagg gttaacggtt cccccaagcc 1681 tctggttaaa tggctaaggg ccagcaactg gctgaccgga ggtcgttaca atgtccaagc 1741 taacggtgac ctggagatcc aagatgtgac attctcggat gccggcaaat acacatgcta 1801 tgcgcagaac aagtttggtg aaattcaagc cgatggttcg ctggtggtca aggagcatac 1861 gagaattacc caagagccgc aaaactacga ggtggccgcc ggacaatcgg ccacgttccg 1921 ctgtaacgag gcccacgacg atacgctgga gattgagatc gattggtgga aggatggcca 1981 gtccattgac tttgaggccc agccgcgatt cgtgaagacc aatgataatt ccctgacgat 2041 tgccaagaca atggagttgg attctggcga atatacgtgc gtggcccgga cgcgtttgga 2101 tgaggcaacg gccagggcga atttgattgt ccaggatgtg ccgaatgcac caaaactgac 2161 cggcatcacc tgccaggccg acaaggccga gatccactgg gaacagcagg gtgacaatcg 2221 ttcgcccatt ctgcactaca ccattcagtt caatacatcg ttcacgcccg cctcctggga 2281 tgccgcctac gagaaggtgc ccaacacgga ctcctcgttc gtcgtccaga tgtcaccgtg 2341 ggccaactat acgttccgtg tgattgcctt caacaagatc ggagcctcgc cgccgtcggc 2401 gcacagcgat agctgcacca cccagccgga tgtgcccttc aagaatcccg acaatgtcgt 2461 tggccagggc actgagccca acaatctggt catctcgtgg actcccatgc ccgaaatcga 2521 gcacaatgcc cccaatttcc attattatgt tagctggaaa cgcgatattc ctgccgctgc 2581 gtgggaaaac aataacatat tcgactggcg acagaacaac attgtgattg ccgatcaacc 2641 gactttcgtg aaatacctga tcaaggtggt ggccatcaac gataggggtg agtccaatgt 2701 ggccgccgag gaggtggttg gctactctgg cgaagatcgt cccctggatg cgcccaccaa 2761 cttcacaatg aggcaaatca catcatcgac cagtggctac atggcctgga cgccggtaag 2821 tgaggaatcg gtgcgcggac acttcaaggg ctacaaaatc caaacgtgga cggagaacga 2881 gggcgaggag ggtctgcggg agatccatgt gaagggtgat acccacaacg ctctggtcac 2941 acaattcaag cccgattcaa agaactatgc ccgcattttg gcttacaatg gacgcttcaa 3001 tggcccaccc agtgccgtca tcgacttcga tactccggag ggtgtaccat cgccggttca 3061 gggactggat gcctatcctc tgggctcctc ggccttcatg ctccactgga agaagccgct 3121 gtatcccaat ggcaagctca ctggctacaa gatctactac gaggaggtta aggagagcta 3181 tgtgggcgag cgacgcgaat acgatccaca catcaccgat cccagggtca cacgcatgaa 3241 gatggccggc ctgaagccca actccaagta ccgcatctcc atcactgcca ccacgaaaat 3301 gggcgaggga tctgaacact atatcgaaaa gaccacgctc aaggatgccg tcaatgtggc 3361 ccctgccacg ccatctttct cctgggagca actgccatcc gacaatggac tagccaagtt 3421 ccgcatcaac tggctgccaa gtaccgaggg tcatccaggc actcacttct ttacgatgca 3481 caggatcaag ggcgaaaccc aatggatacg cgagaatgag gaaaagaact ccgattacca 3541 ggaggtcggt ggcttagatc cggagaccgc ctacgagttc cgcgtggtgt ccgtggatgg 3601 ccactttaac acggagagtg ccacgcagga gatcgacacg aacaccgttg agggaccaat 3661 aatggtggcc aacgagacgg tggccaatgc cggatggttc attggcatga tgctggccct 3721 ggccttcatc atcatcctct tcatcatcat ctgcattatc cgacgcaatc ggggcggaaa 3781 gtacgatgtc cacgatcggg agctggccaa cggccggcgg gattatcccg aagagggcgg 3841 attccacgag tactcgcaac cgttggataa caagagcgct ggtcgccaat ccgtgagttc 3901 agcgaacaaa ccgggcgtgg aaagcgatac tgattcgatg gccgaatacg gtgatggcga 3961 tacaggacaa tttaccgagg atggctcctt cattggccaa tatgttcctg gaaagctcca 4021 accgccggtt agcccacagc cactgaacaa ttccgctgcg gcgcatcagg cggcgccaac 4081 tgccggagga tcgggagcag ccggatcggc agcagcagcc ggagcatcgg gtggagcatc 4141 gtccgccgga ggagcagctg ccagcaatgg aggagctgca gccggagccg tggccaccta 4201 cgtctaagag gcgtggctgg gattcacttg ccccattgtt ctcctgattt tctaccaaac 4261 gattcaaacg cctcttaaac aaaaaagaaa ctgtgtaatt ctatgtgtaa aacgaaaact 4321 gctttaagtg tctgcaaaaa aaaaaaaaaa aacaagaaag aagaaaaaac attataatta 4381 actcaaatcg agaaacaatt gtaaagtgaa gaaaaactcg catgaattta aagcatataa 4441 ttttgcttct tttggcttat gaaattatta tagcaaacag ttaaacgcct tttccaaaac 4501 aaaaacaaag aaacttttgt ataagcttaa aaaaaaaaaa agaaaccaaa acacaaaaaa 4561 tgaatgtaaa cgttgacaaa tgtatggaga agtagaagga cgattaatga taatgcctgt 4621 tttgtgtaat aatttttttt tttttataac aaaaatacct ttaagttatt ggtggcacaa 4681 ggatatcatt gtctacatgg aaaccaagtc gagtttgtaa gccaaagagc cggcgaacca 4741 aggagtcgag tgagggaatg gaggcaatag cgacagatat atgcgtttat atatcgattc 4801 cggtctcagc taaactagga actgttcaaa atgtacaaaa aaaaaaacca aggcttaaat 4861 gagaaccatc gggcagcttc gatcaattga tcaatgactg aattgcgaag aaaatgcctt 4921 gactattttg ctcctcaatg tccaatgact aaccaaaata tatcgatgtg ttcaactagc 4981 agcaagtcaa atactcaact tgaactcgat caactgttcg ccaatcaaag actttaaggg 5041 cagagcagat attccagcgc caattcaaaa aaaaaaaatc caggagagcc tgaggcagca 5101 gcagctttcc tttgtcggca attcgcatat atgtatattt atgtatgtgt atcgtataag 5161 ttccgatttt cgtccatagt ctaatgcaat ttttcgcgtc tagtatttaa acagaatcct 5221 ttcagtttgt ccattaatga gttaagtaaa gcaaattagt taattaacaa attagttggc 5281 ccactcgcac gagtcggtca ttgtaaccta tatgattaaa cgaataatac gcagctgaca 5341 aacctataat tgttccacat agtactccct cttatttgaa tgaaaatgtt aaaaaaacaa 5401 aaaccctcga gatgccagtt gcgtctctgg ttttcacttt aatccaaata tctgtaataa 5461 taacgatgta ttcataattt tttttaaaaa ctaaaaaaca cacacaaagt ggcactagag 5521 tctaatgaaa taaaaacaca ataaaaacaa atgaagtaaa aaaaaaatac aattttagtt 5581 tttgaaaatc ttctttgccg ctttgagaga agaaacgctt tgaactttgt atgaaactcg 5641 atcaaaatat atatatatag taatatatat tttttagtgt acacactgcg ctttaatcga 5701 cacccgaaga acatgaaaaa caacaacaac aaaaacacaa tcccataact gactagattt 5761 ttgagacgtt aattcgaatc ggttcggctt tatttgcgaa ttaggcagta tattaagtat 5821 ataccttagg tggataaata agcttatgat aatttggtct ttaacgaaca tacagggttg 5881 cttagtcaaa tttttgcata gatttacgga ttacgaaaaa cataattgcc ggtgtaggcg 5941 tgtaattgga tgactcatat tttgtgcact gcgttctgtt tgttgttatt tcaattagct 6001 acctatgtat gtataatgaa ctataatatc cggcttcagc atagttttca atcgaataac 6061 caatacccag cctccccaaa aaccgagccc acactaaaaa aaaaattggg agacaaccga 6121 aacgatccac aaacataatt cacctgcacc acgcatatcc caacgattga tatagcagat 6181 atacgatgag gaagtagagc ggagggaaaa ctaggaaact agatcggaaa aaggacatgc 6241 aaggacaaca agacaaaaga actacataaa acaatacaaa acaaaacttg ctatacaaac 6301 gtatatatgg atatatgata tatatttaca gtatagagga caacgatcta aatctaatgt 6361 tcatgacaaa gcgatatata tatatacata caaaacatat agagagatgt ataagatttt 6421 gcatagatat tgtgatttcc caaaaacaaa aaagaaaaac tcaaaatagt caataacaat 6481 gtggaaactg agaaaccaaa cgtaaaccaa ttaactaaac taatatttcc tcctttgtcg 6541 tatgaaataa aaaactaact aaagtgttca tcagtggaat tttcgaaata atcgctcgtc 6601 ttcgatgaca gagcttagac ttcgatagcg atagaaccac aacaacaaga acaacaacaa 6661 caactgcact gcctgtgtcg ggttctattt tacatttaca tctacattta cagaatcata 6721 agaattcaca cactctaata agcgccagtc ggaggaattc agaattgaaa actcagaatg 6781 ccgaaagcta aacaacatcc caagcaaaca ttttgaaact aataaaggta atttgcacaa 6841 tactgtgatt cctagcaaga aacaatgaga cacgatgaac aattaacgat aaacgctatt 6901 aattatcgac ttttgtgtgt ttgtgtggtt tggaaatcga tgtgtttgta ttgtacgtat 6961 atttttcaca gcatgctgaa aaatgtttgc aacaagaact atttatctaa ccactcagta 7021 atatccaact tgatcaattt acttgcatat gattattacg attattattg ctaaccaaag 7081 gcccaaacaa taacttaaat ataacgcaga atgaaatcga aaacaaatga taaaacaaca 7141 agaatacaaa gtactttttt aaaatgagtt tttagcgaat caaatataaa cttaagattt 7201 aaaaaaaaat tcgtatacaa caaacaagca taaatgatag cagcgtctac aaaatccaca 7261 accagatcag aaaaagcagg agaataatca aaacgagaaa atggagaaaa ggttatccag 7321 aaaaatgatc agaaaacgtg taagctgtaa aacctataat gagaaataaa ctatagaaac 7381 tatatg