Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NM_001169233 5059 bp mRNA linear INV 26-DEC-2023 mRNA. ACCESSION NM_001169233 VERSION NM_001169233.2 DBLINK BioProject: PRJNA164 BioSample: SAMN02803731 KEYWORDS RefSeq. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 5059) AUTHORS Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K., Strelets,V., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data JOURNAL G3 (Bethesda) 5 (8), 1721-1736 (2015) PUBMED 26109357 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 5059) AUTHORS Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B., Russo,S.M. and Gelbart,W.M. CONSRTM FlyBase Consortium TITLE Gene Model Annotations for Drosophila melanogaster: The Rule-Benders JOURNAL G3 (Bethesda) 5 (8), 1737-1749 (2015) PUBMED 26109356 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 5059) AUTHORS Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I., Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R., Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G., Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N., Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A., Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E. TITLE The Release 6 reference sequence of the Drosophila melanogaster genome JOURNAL Genome Res 25 (3), 445-458 (2015) PUBMED 25589440 REFERENCE 4 (bases 1 to 5059) AUTHORS Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M., Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F., Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E. TITLE Sequence finishing and mapping of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1625-1628 (2007) PUBMED 17569867 REFERENCE 5 (bases 1 to 5059) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. TITLE The Release 5.1 annotation of Drosophila melanogaster heterochromatin JOURNAL Science 316 (5831), 1586-1591 (2007) PUBMED 17569856 REMARK Erratum:[Science. 2007 Sep 7;317(5843):1325] REFERENCE 6 (bases 1 to 5059) AUTHORS Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D., Ashburner,M. and Anxolabehere,D. TITLE Combined evidence annotation of transposable elements in genome sequences JOURNAL PLoS Comput Biol 1 (2), 166-175 (2005) PUBMED 16110336 REFERENCE 7 (bases 1 to 5059) AUTHORS Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A., Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A., Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W., Celniker,S.E., Rubin,G.M. and Karpen,G.H. TITLE Heterochromatic sequences in a Drosophila whole-genome shotgun assembly JOURNAL Genome Biol 3 (12), RESEARCH0085 (2002) PUBMED 12537574 REFERENCE 8 (bases 1 to 5059) AUTHORS Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J., Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E., Rubin,G.M., Ashburner,M. and Celniker,S.E. TITLE The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective JOURNAL Genome Biol 3 (12), RESEARCH0084 (2002) PUBMED 12537573 REFERENCE 9 (bases 1 to 5059) AUTHORS Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S., Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E., Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L., Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D., Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J., Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M., Rubin,G.M. and Lewis,S.E. TITLE Annotation of the Drosophila melanogaster euchromatic genome: a systematic review JOURNAL Genome Biol 3 (12), RESEARCH0083 (2002) PUBMED 12537572 REFERENCE 10 (bases 1 to 5059) AUTHORS Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W., Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E., Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M., Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S., Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M., Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W., Gibbs,R.A. and Rubin,G.M. TITLE Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence JOURNAL Genome Biol 3 (12), RESEARCH0079 (2002) PUBMED 12537568 REFERENCE 11 (bases 1 to 5059) AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D., Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F., George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N., Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X., Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D., Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L., Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S., Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z., Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J., Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J., Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z., Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C., Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A., Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C., McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C., Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L., Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K., Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S., Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K., Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I., Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C., Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R., Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A., Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT, Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F., Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H., Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O., Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C. TITLE The genome sequence of Drosophila melanogaster JOURNAL Science 287 (5461), 2185-2195 (2000) PUBMED 10731132 REFERENCE 12 (bases 1 to 5059) AUTHORS Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R., Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R., Smith,E., Yu,C. and Rubin,G. CONSRTM Berkeley Drosophila Genome Project TITLE Drosophila melanogaster release 4 sequence JOURNAL Unpublished REFERENCE 13 (bases 1 to 5059) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 14 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (13-DEC-2023) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 15 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 16 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (20-APR-2020) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 17 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (22-APR-2019) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 18 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (24-MAY-2018) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 19 (bases 1 to 5059) CONSRTM FlyBase TITLE Direct Submission JOURNAL Submitted (07-DEC-2016) FlyBase, Harvard University, Biological Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA REFERENCE 20 (bases 1 to 5059) AUTHORS Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Karpen,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 21 (bases 1 to 5059) AUTHORS Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S., Svirskas,R. and Rubin,G. TITLE Direct Submission JOURNAL Submitted (10-AUG-2006) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA REMARK Direct Submission REFERENCE 22 (bases 1 to 5059) AUTHORS Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H. CONSRTM Drosophila Heterochromatin Genome Project TITLE Direct Submission JOURNAL Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project, Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Mailstop 64-121, Berkeley, CA 94720, USA REFERENCE 23 (bases 1 to 5059) AUTHORS Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J. TITLE Direct Submission JOURNAL Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA COMMENT REVIEWED REFSEQ: This record has been curated by FlyBase. This record is derived from an annotated genomic sequence (NC_004354). On May 8, 2012 this sequence version replaced NM_001169233.1. ##Genome-Annotation-Data-START## Annotation Provider :: FlyBase Annotation Status :: Full annotation Annotation Version :: Release 6.54 URL :: http://flybase.org ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5059 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="X" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..5059 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Neuroglian" /map="7F2-7F4" /db_xref="FLYBASE:FBgn0264975" /db_xref="GeneID:31792" CDS 268..3987 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="CG1634 gene product from transcript CG1634-RD; CG1634-PD; Nrg-PD; icebox; central brain deranged; neuroglian; lethal (1) G0488; female sterile(1)M72" /codon_start=1 /product="neuroglian, isoform D" /protein_id="NP_001162704.1" /db_xref="FLYBASE:FBpp0290976" /db_xref="GeneID:31792" /db_xref="FLYBASE:FBgn0264975" /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL" misc_feature 352..651 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 430..444 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 469..483 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 547..561 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 589..606 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 631..642 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 676..915 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 718..732 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 760..774 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 841..855 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 892..909 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1018..1263 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 1057..1071 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1096..1110 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1180..1194 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1207..1224 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1249..1260 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1282..1548 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 1282..1293 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 1309..1320 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 1333..1356 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1372..1389 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1396..1404 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 1426..1440 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 1444..1458 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1483..1509 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1516..1548 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 1603..1818 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1612..1626 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1651..1665 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1714..1728 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1756..1773 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1795..1806 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1828..2112 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1879..1893 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1924..1938 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1996..2010 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 2038..2055 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2077..2088 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 2104..2388 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature 2314..>3420 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain [General function prediction only]; Region: FN3; COG3401" /db_xref="CDD:442628" misc_feature order(2353..2358,2362..2367) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3016..3018,3226..3228,3271..3273) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3019..3288 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3388..3600 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(3577..3582,3586..3591) /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3730..3978 /gene="Nrg" /locus_tag="Dmel_CG1634" /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72; ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl; nrg; NRG; Nrg167; Nrg180; RA35" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" ORIGIN 1 agtgtgcgtt cgtgtgttgc aacagcagaa agtaataaaa gctcggctcg catgcaattt 61 tcattagtgg gaaaattgtt tgatatttaa gaggcaaccg aggaataaac ggaatcaaca 121 gcagcagaca cacacacaca cattccaagc caaattaata atagaaaaga aaaacaaaaa 181 aaaaaaaaca gcaaccagaa aaccaataaa agtttaaacc aaaacgaaac acactcgagg 241 gggcgagcgg agagccaaac gaccaaaatg tggcggcagt caacgatact ggccgcgtta 301 ctagtggctc ttttgtgtgc gggcagtgca gaaagcaaag gcaatcgccc accaagaatc 361 accaaacaac cggcacccgg agaattgctc ttcaaagtgg cgcaacagaa taaggaaagt 421 gacaatccat tcataatcga gtgcgaagcc gatggacaac ccgagccaga atatagttgg 481 atcaagaacg gcaagaagtt cgattggcag gcgtacgata accgcatgct gcggcagcca 541 ggacgtggca ccctggtgat caccataccc aaggacgagg atcgcggcca ctatcagtgc 601 tttgcgtcca atgaattcgg aacggccacc tcgaactcag tatatgtgcg taaggccgag 661 ctgaatgcct tcaaggatga ggcggccaag acactggagg ccgtcgaggg tgagcccttt 721 atgctgaaat gtgccgcacc cgatggtttt cccagtccga cagtcaactg gatgatccag 781 gagtccatcg atggcagcat caagtcgatc aacaactctc gcatgaccct cgatcctgag 841 ggtaatctct ggttctcgaa tgttacccgt gaggatgcca gctccgattt ctactatgcc 901 tgctcggcca cctcggtgtt tcgcagtgaa tacaagattg gcaacaaggt gctcctcgat 961 gtcaaacaga tgggcgttag tgcctcgcag aacaagcatc cgcccgtgcg tcaatatgtt 1021 tcccgtcgcc agtccttggc gttgcgtggc aagcgaatgg aactgttttg catctacggt 1081 ggaacaccgc tgccgcagac cgtgtggagc aaggatggcc agcgtataca gtggagcgat 1141 cgaataacgc aaggacacta tggcaaatca ctggtcattc ggcagacaaa tttcgatgat 1201 gccggcacat acacctgcga cgtgtccaac ggtgtgggca atgcccaatc cttctccatc 1261 attctgaatg ttaactccgt gccgtacttt accaaagaac ctgaaatcgc caccgccgcc 1321 gaagacgaag aggttgtctt cgagtgtcgc gctgctggtg taccagagcc caagatcagt 1381 tggattcaca atggtaagcc catcgagcag agcaccccga atccccgacg aacggttacg 1441 gacaacacaa ttcgcattat caatctggtt aagggcgata ctggtaacta cggttgcaac 1501 gccaccaatt cgctgggata tgtgtataag gatgtctatc taaatgtcca ggctgagccg 1561 ccaacgattt ccgaagctcc agcagctgta tccactgtcg atggaaggaa tgtgaccatt 1621 aagtgcaggg ttaacggttc ccccaagcct ctggttaaat ggctaagggc cagcaactgg 1681 ctgaccggag gtcgttacaa tgtccaagct aacggtgacc tggagatcca agatgtgaca 1741 ttctcggatg ccggcaaata cacatgctat gcgcagaaca agtttggtga aattcaagcc 1801 gatggttcgc tggtggtcaa ggagcatacg agaattaccc aagagccgca aaactacgag 1861 gtggccgccg gacaatcggc cacgttccgc tgtaacgagg cccacgacga tacgctggag 1921 attgagatcg attggtggaa ggatggccag tccattgact ttgaggccca gccgcgattc 1981 gtgaagacca atgataattc cctgacgatt gccaagacaa tggagttgga ttctggcgaa 2041 tatacgtgcg tggcccggac gcgtttggat gaggcaacgg ccagggcgaa tttgattgtc 2101 caggatgtgc cgaatgcacc aaaactgacc ggcatcacct gccaggccga caaggccgag 2161 atccactggg aacagcaggg tgacaatcgt tcgcccattc tgcactacac cattcagttc 2221 aatacatcgt tcacgcccgc ctcctgggat gccgcctacg agaaggtgcc caacacggac 2281 tcctcgttcg tcgtccagat gtcaccgtgg gccaactata cgttccgtgt gattgccttc 2341 aacaagatcg gagcctcgcc gccgtcggcg cacagcgata gctgcaccac ccagccggat 2401 gtgcccttca agaatcccga caatgtcgtt ggccagggca ctgagcccaa caatctggtc 2461 atctcgtgga ctcccatgcc cgaaatcgag cacaatgccc ccaatttcca ttattatgtt 2521 agctggaaac gcgatattcc tgccgctgcg tgggaaaaca ataacatatt cgactggcga 2581 cagaacaaca ttgtgattgc cgatcaaccg actttcgtga aatacctgat caaggtggtg 2641 gccatcaacg ataggggtga gtccaatgtg gccgccgagg aggtggttgg ctactctggc 2701 gaagatcgtc ccctggatgc gcccaccaac ttcacaatga ggcaaatcac atcatcgacc 2761 agtggctaca tggcctggac gccggtaagt gaggaatcgg tgcgcggaca cttcaagggc 2821 tacaaaatcc aaacgtggac ggagaacgag ggcgaggagg gtctgcggga gatccatgtg 2881 aagggtgata cccacaacgc tctggtcaca caattcaagc ccgattcaaa gaactatgcc 2941 cgcattttgg cttacaatgg acgcttcaat ggcccaccca gtgccgtcat cgacttcgat 3001 actccggagg gtgtaccatc gccggttcag ggactggatg cctatcctct gggctcctcg 3061 gccttcatgc tccactggaa gaagccgctg tatcccaatg gcaagctcac tggctacaag 3121 atctactacg aggaggttaa ggagagctat gtgggcgagc gacgcgaata cgatccacac 3181 atcaccgatc ccagggtcac acgcatgaag atggccggcc tgaagcccaa ctccaagtac 3241 cgcatctcca tcactgccac cacgaaaatg ggcgagggat ctgaacacta tatcgaaaag 3301 accacgctca aggatgccgt caatgtggcc cctgccacgc catctttctc ctgggagcaa 3361 ctgccatccg acaatggact agccaagttc cgcatcaact ggctgccaag taccgagggt 3421 catccaggca ctcacttctt tacgatgcac aggatcaagg gcgaaaccca atggatacgc 3481 gagaatgagg aaaagaactc cgattaccag gaggtcggtg gcttagatcc ggagaccgcc 3541 tacgagttcc gcgtggtgtc cgtggatggc cactttaaca cggagagtgc cacgcaggag 3601 atcgacacga acaccgttga gggaccaata atggtggcca acgagacggt ggccaatgcc 3661 ggatggttca ttggcatgat gctggccctg gccttcatca tcatcctctt catcatcatc 3721 tgcattatcc gacgcaatcg gggcggaaag tacgatgtcc acgatcggga gctggccaac 3781 ggccggcggg attatcccga agagggcgga ttccacgagt actcgcaacc gttggataac 3841 aagagcgctg gtcgccaatc cgtgagttca gcgaacaaac cgggcgtgga aagcgatact 3901 gattcgatgg ccgaatacgg tgatggcgat acaggcatga atgaagatgg atcctttatt 3961 ggccaatatg gacgcaaagg actttgattt aattagtaag cagcgcaccg caacagcaac 4021 tcaaaaataa tatcgaaacc gagcccttaa ccccaaaaat caaaaaatca acaagaccaa 4081 acaccatcac agcagaaaaa tgaaaaaatt aatgaaaata atagtagcct acattttatt 4141 cgactataag tgcaaacacc acgactaatt taaagtatat ataaaaatag aggttttata 4201 tataactatt aaaatcttaa aatgtgtaaa aaaaaaaaca aacaaacaaa atgaatgcaa 4261 atcaatactg ccaaacaact tgaacaacaa gcaacacaac agcaaaaaca acaacaacga 4321 gaatgcagca aaaaggctat tatcaaaata aaagtcttca tatcggaaga agtagttatc 4381 gaaaaagaaa tgcatgcgaa tcaaaccgaa ttatgaaaaa aaaaatcata taattttctg 4441 gacgttatgg ggatgatgcg tgtaattttt ttttatttta aagaaattta agaaactatg 4501 tatgaggaaa ataatgaagc tcgcttatga aatctctata ttgcgcacat gtctacctgt 4561 cccactctgt ccccggtact ctgtatatct ttgtcccgct ctctcccttc tctacttgta 4621 atgcatatat atttataaat ataaagcgta aataagttat aatttagtaa tttttttata 4681 aagcaacagc acttgaatgt caaatctccg ttttagattg gtcgtaaatc gaaatgaaac 4741 tctcttttag cttacatgtt tactacttta tttaagccta ttgtgtgtat tttgttttta 4801 tttcattatt ttattttttt tagttcgtgt aatgactttg aatttttttg ctttgaaatt 4861 gaaacaatgt tttagtatag cctcgtgttt gttttccggg aagagcaaca aaaatgaagt 4921 gtattttttc agtgtattta atattaaaga atgaatgacg aaaacatcat aattatatga 4981 aaatataatt ttttttacat atgttgatgt acgttcgcat ataaatttag aaagaaaaca 5041 aataaaataa agaaaaccg