Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster neuroglian, transcript variant D (Nrg),


LOCUS       NM_001169233            5059 bp    mRNA    linear   INV 26-DEC-2023
            mRNA.
ACCESSION   NM_001169233
VERSION     NM_001169233.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 5059)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5059)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 5059)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 5059)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 5059)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 5059)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 5059)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 5059)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 5059)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 5059)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 5059)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 5059)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 5059)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 5059)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 5059)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 5059)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 5059)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 5059)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On May 8, 2012 this sequence version replaced NM_001169233.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5059
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..5059
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Neuroglian"
                     /map="7F2-7F4"
                     /db_xref="FLYBASE:FBgn0264975"
                     /db_xref="GeneID:31792"
     CDS             268..3987
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="CG1634 gene product from transcript CG1634-RD;
                     CG1634-PD; Nrg-PD; icebox; central brain deranged;
                     neuroglian; lethal (1) G0488; female sterile(1)M72"
                     /codon_start=1
                     /product="neuroglian, isoform D"
                     /protein_id="NP_001162704.1"
                     /db_xref="FLYBASE:FBpp0290976"
                     /db_xref="GeneID:31792"
                     /db_xref="FLYBASE:FBgn0264975"
                     /translation="MWRQSTILAALLVALLCAGSAESKGNRPPRITKQPAPGELLFKV
                     AQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPK
                     DEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDG
                     FPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVF
                     RSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLP
                     QTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILN
                     VNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTD
                     NTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVT
                     IKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGE
                     IQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFE
                     AQPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGIT
                     CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWA
                     NYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEI
                     EHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGE
                     SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQT
                     WTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPE
                     GVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHI
                     TDPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWE
                     QLPSDNGLAKFRINWLPSTEGHPGTHFFTMHRIKGETQWIRENEEKNSDYQEVGGLDP
                     ETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIII
                     LFIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANK
                     PGVESDTDSMAEYGDGDTGMNEDGSFIGQYGRKGL"
     misc_feature    352..651
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    430..444
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    469..483
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    547..561
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    589..606
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    631..642
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    676..915
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    718..732
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    760..774
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    841..855
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    892..909
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1018..1263
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: ig; pfam00047"
                     /db_xref="CDD:395002"
     misc_feature    1057..1071
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1096..1110
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1180..1194
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1207..1224
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1249..1260
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1282..1548
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fourth immunoglobulin (Ig)-like domain of hemolin,
                     and similar domains; a member of the I-set of IgSF
                     domains; Region: IgI_4_hemolin-like; cd20978"
                     /db_xref="CDD:409570"
     misc_feature    1282..1293
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409570"
     misc_feature    1309..1320
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409570"
     misc_feature    1333..1356
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    1372..1389
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1396..1404
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409570"
     misc_feature    1426..1440
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409570"
     misc_feature    1444..1458
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1483..1509
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1516..1548
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    1603..1818
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1612..1626
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1651..1665
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1714..1728
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1756..1773
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1795..1806
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    1828..2112
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    1879..1893
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1924..1938
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1996..2010
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    2038..2055
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2077..2088
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    2104..2388
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    2314..>3420
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2353..2358,2362..2367)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3016..3018,3226..3228,3271..3273)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3019..3288
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3388..3600
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(3577..3582,3586..3591)
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    3730..3978
                     /gene="Nrg"
                     /locus_tag="Dmel_CG1634"
                     /gene_synonym="ceb; CG1634; CT4318; Dmel\CG1634; fs(1)M72;
                     ibx; l(1)7Fa; l(1)G0099; l(1)G0413; l(1)G0488; NFASC; Ngl;
                     nrg; NRG; Nrg167; Nrg180; RA35"
                     /note="Bravo-like intracellular region; Region:
                     Bravo_FIGEY; pfam13882"
                     /db_xref="CDD:464016"
ORIGIN      
        1 agtgtgcgtt cgtgtgttgc aacagcagaa agtaataaaa gctcggctcg catgcaattt
       61 tcattagtgg gaaaattgtt tgatatttaa gaggcaaccg aggaataaac ggaatcaaca
      121 gcagcagaca cacacacaca cattccaagc caaattaata atagaaaaga aaaacaaaaa
      181 aaaaaaaaca gcaaccagaa aaccaataaa agtttaaacc aaaacgaaac acactcgagg
      241 gggcgagcgg agagccaaac gaccaaaatg tggcggcagt caacgatact ggccgcgtta
      301 ctagtggctc ttttgtgtgc gggcagtgca gaaagcaaag gcaatcgccc accaagaatc
      361 accaaacaac cggcacccgg agaattgctc ttcaaagtgg cgcaacagaa taaggaaagt
      421 gacaatccat tcataatcga gtgcgaagcc gatggacaac ccgagccaga atatagttgg
      481 atcaagaacg gcaagaagtt cgattggcag gcgtacgata accgcatgct gcggcagcca
      541 ggacgtggca ccctggtgat caccataccc aaggacgagg atcgcggcca ctatcagtgc
      601 tttgcgtcca atgaattcgg aacggccacc tcgaactcag tatatgtgcg taaggccgag
      661 ctgaatgcct tcaaggatga ggcggccaag acactggagg ccgtcgaggg tgagcccttt
      721 atgctgaaat gtgccgcacc cgatggtttt cccagtccga cagtcaactg gatgatccag
      781 gagtccatcg atggcagcat caagtcgatc aacaactctc gcatgaccct cgatcctgag
      841 ggtaatctct ggttctcgaa tgttacccgt gaggatgcca gctccgattt ctactatgcc
      901 tgctcggcca cctcggtgtt tcgcagtgaa tacaagattg gcaacaaggt gctcctcgat
      961 gtcaaacaga tgggcgttag tgcctcgcag aacaagcatc cgcccgtgcg tcaatatgtt
     1021 tcccgtcgcc agtccttggc gttgcgtggc aagcgaatgg aactgttttg catctacggt
     1081 ggaacaccgc tgccgcagac cgtgtggagc aaggatggcc agcgtataca gtggagcgat
     1141 cgaataacgc aaggacacta tggcaaatca ctggtcattc ggcagacaaa tttcgatgat
     1201 gccggcacat acacctgcga cgtgtccaac ggtgtgggca atgcccaatc cttctccatc
     1261 attctgaatg ttaactccgt gccgtacttt accaaagaac ctgaaatcgc caccgccgcc
     1321 gaagacgaag aggttgtctt cgagtgtcgc gctgctggtg taccagagcc caagatcagt
     1381 tggattcaca atggtaagcc catcgagcag agcaccccga atccccgacg aacggttacg
     1441 gacaacacaa ttcgcattat caatctggtt aagggcgata ctggtaacta cggttgcaac
     1501 gccaccaatt cgctgggata tgtgtataag gatgtctatc taaatgtcca ggctgagccg
     1561 ccaacgattt ccgaagctcc agcagctgta tccactgtcg atggaaggaa tgtgaccatt
     1621 aagtgcaggg ttaacggttc ccccaagcct ctggttaaat ggctaagggc cagcaactgg
     1681 ctgaccggag gtcgttacaa tgtccaagct aacggtgacc tggagatcca agatgtgaca
     1741 ttctcggatg ccggcaaata cacatgctat gcgcagaaca agtttggtga aattcaagcc
     1801 gatggttcgc tggtggtcaa ggagcatacg agaattaccc aagagccgca aaactacgag
     1861 gtggccgccg gacaatcggc cacgttccgc tgtaacgagg cccacgacga tacgctggag
     1921 attgagatcg attggtggaa ggatggccag tccattgact ttgaggccca gccgcgattc
     1981 gtgaagacca atgataattc cctgacgatt gccaagacaa tggagttgga ttctggcgaa
     2041 tatacgtgcg tggcccggac gcgtttggat gaggcaacgg ccagggcgaa tttgattgtc
     2101 caggatgtgc cgaatgcacc aaaactgacc ggcatcacct gccaggccga caaggccgag
     2161 atccactggg aacagcaggg tgacaatcgt tcgcccattc tgcactacac cattcagttc
     2221 aatacatcgt tcacgcccgc ctcctgggat gccgcctacg agaaggtgcc caacacggac
     2281 tcctcgttcg tcgtccagat gtcaccgtgg gccaactata cgttccgtgt gattgccttc
     2341 aacaagatcg gagcctcgcc gccgtcggcg cacagcgata gctgcaccac ccagccggat
     2401 gtgcccttca agaatcccga caatgtcgtt ggccagggca ctgagcccaa caatctggtc
     2461 atctcgtgga ctcccatgcc cgaaatcgag cacaatgccc ccaatttcca ttattatgtt
     2521 agctggaaac gcgatattcc tgccgctgcg tgggaaaaca ataacatatt cgactggcga
     2581 cagaacaaca ttgtgattgc cgatcaaccg actttcgtga aatacctgat caaggtggtg
     2641 gccatcaacg ataggggtga gtccaatgtg gccgccgagg aggtggttgg ctactctggc
     2701 gaagatcgtc ccctggatgc gcccaccaac ttcacaatga ggcaaatcac atcatcgacc
     2761 agtggctaca tggcctggac gccggtaagt gaggaatcgg tgcgcggaca cttcaagggc
     2821 tacaaaatcc aaacgtggac ggagaacgag ggcgaggagg gtctgcggga gatccatgtg
     2881 aagggtgata cccacaacgc tctggtcaca caattcaagc ccgattcaaa gaactatgcc
     2941 cgcattttgg cttacaatgg acgcttcaat ggcccaccca gtgccgtcat cgacttcgat
     3001 actccggagg gtgtaccatc gccggttcag ggactggatg cctatcctct gggctcctcg
     3061 gccttcatgc tccactggaa gaagccgctg tatcccaatg gcaagctcac tggctacaag
     3121 atctactacg aggaggttaa ggagagctat gtgggcgagc gacgcgaata cgatccacac
     3181 atcaccgatc ccagggtcac acgcatgaag atggccggcc tgaagcccaa ctccaagtac
     3241 cgcatctcca tcactgccac cacgaaaatg ggcgagggat ctgaacacta tatcgaaaag
     3301 accacgctca aggatgccgt caatgtggcc cctgccacgc catctttctc ctgggagcaa
     3361 ctgccatccg acaatggact agccaagttc cgcatcaact ggctgccaag taccgagggt
     3421 catccaggca ctcacttctt tacgatgcac aggatcaagg gcgaaaccca atggatacgc
     3481 gagaatgagg aaaagaactc cgattaccag gaggtcggtg gcttagatcc ggagaccgcc
     3541 tacgagttcc gcgtggtgtc cgtggatggc cactttaaca cggagagtgc cacgcaggag
     3601 atcgacacga acaccgttga gggaccaata atggtggcca acgagacggt ggccaatgcc
     3661 ggatggttca ttggcatgat gctggccctg gccttcatca tcatcctctt catcatcatc
     3721 tgcattatcc gacgcaatcg gggcggaaag tacgatgtcc acgatcggga gctggccaac
     3781 ggccggcggg attatcccga agagggcgga ttccacgagt actcgcaacc gttggataac
     3841 aagagcgctg gtcgccaatc cgtgagttca gcgaacaaac cgggcgtgga aagcgatact
     3901 gattcgatgg ccgaatacgg tgatggcgat acaggcatga atgaagatgg atcctttatt
     3961 ggccaatatg gacgcaaagg actttgattt aattagtaag cagcgcaccg caacagcaac
     4021 tcaaaaataa tatcgaaacc gagcccttaa ccccaaaaat caaaaaatca acaagaccaa
     4081 acaccatcac agcagaaaaa tgaaaaaatt aatgaaaata atagtagcct acattttatt
     4141 cgactataag tgcaaacacc acgactaatt taaagtatat ataaaaatag aggttttata
     4201 tataactatt aaaatcttaa aatgtgtaaa aaaaaaaaca aacaaacaaa atgaatgcaa
     4261 atcaatactg ccaaacaact tgaacaacaa gcaacacaac agcaaaaaca acaacaacga
     4321 gaatgcagca aaaaggctat tatcaaaata aaagtcttca tatcggaaga agtagttatc
     4381 gaaaaagaaa tgcatgcgaa tcaaaccgaa ttatgaaaaa aaaaatcata taattttctg
     4441 gacgttatgg ggatgatgcg tgtaattttt ttttatttta aagaaattta agaaactatg
     4501 tatgaggaaa ataatgaagc tcgcttatga aatctctata ttgcgcacat gtctacctgt
     4561 cccactctgt ccccggtact ctgtatatct ttgtcccgct ctctcccttc tctacttgta
     4621 atgcatatat atttataaat ataaagcgta aataagttat aatttagtaa tttttttata
     4681 aagcaacagc acttgaatgt caaatctccg ttttagattg gtcgtaaatc gaaatgaaac
     4741 tctcttttag cttacatgtt tactacttta tttaagccta ttgtgtgtat tttgttttta
     4801 tttcattatt ttattttttt tagttcgtgt aatgactttg aatttttttg ctttgaaatt
     4861 gaaacaatgt tttagtatag cctcgtgttt gttttccggg aagagcaaca aaaatgaagt
     4921 gtattttttc agtgtattta atattaaaga atgaatgacg aaaacatcat aattatatga
     4981 aaatataatt ttttttacat atgttgatgt acgttcgcat ataaatttag aaagaaaaca
     5041 aataaaataa agaaaaccg