Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster protein tyrosine phosphatase 10D,


LOCUS       NM_001144715            7269 bp    mRNA    linear   INV 26-DEC-2023
            transcript variant E (Ptp10D), mRNA.
ACCESSION   NM_001144715
VERSION     NM_001144715.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 7269)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7269)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 7269)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 7269)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 7269)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 7269)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 7269)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 7269)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 7269)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 7269)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 7269)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 7269)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 7269)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 7269)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 7269)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 7269)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 7269)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 7269)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 16, 2013 this sequence version replaced NM_001144715.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..7269
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..7269
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Protein tyrosine phosphatase 10D"
                     /map="10D1-10D4"
                     /db_xref="FLYBASE:FBgn0004370"
                     /db_xref="GeneID:32115"
     CDS             617..5293
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /EC_number="3.1.3.-"
                     /EC_number="3.1.3.48"
                     /note="CG1817 gene product from transcript CG1817-RE;
                     CG1817-PE; Ptp10D-PE; protein tyrosine phosphatase 10B"
                     /codon_start=1
                     /product="protein tyrosine phosphatase 10D, isoform E"
                     /protein_id="NP_001138187.1"
                     /db_xref="FLYBASE:FBpp0271743"
                     /db_xref="GeneID:32115"
                     /db_xref="FLYBASE:FBgn0004370"
                     /translation="MLYQLSKATTRIRLKRQKAVPQHRWLWSLAFLAAFTLKDVRCAD
                     LAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWL
                     YYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVLG
                     LSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPN
                     TPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ
                     AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLW
                     EAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGKV
                     TSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIVYHELETFNGD
                     TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPSSPIIEDLKSIR
                     MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVIKNLQPGAGYELKVFAV
                     SHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYSIRYRTDSEQ
                     QWVRLPSVRSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPNPVSNIIQL
                     VDSRNITLEWPKPEGRVESYILKWWPSDNPGRVQTKNVSENKSADDLSTVRVLIGELM
                     PGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITLSYTPTPQ
                     SSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGVASLPI
                     QRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNE
                     ITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPS
                     EINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVF
                     KIQAKTAIGFGPEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNG
                     QVRMYTIIVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGT
                     ENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITV
                     PLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYR
                     LMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDD
                     DEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGR
                     EKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPD
                     FGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYV
                     DIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKENIVGPAREMHDNEGYEDDEG
                     IAESGM"
     misc_feature    <758..1846
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(983..985,1178..1180,1223..1225)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    986..1231
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1226..1231,1235..1240)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(1265..1267,1466..1468,1511..1513)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    1274..1528
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(1514..1519,1523..1528)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    1829..2098
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(1829..1831,2018..2020,2063..2065)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(2066..2071,2075..2080)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2147..2338
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    <2270..>2728
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain [General function
                     prediction only]; Region: FN3; COG3401"
                     /db_xref="CDD:442628"
     misc_feature    order(2633..2635,2837..2839,2882..2884)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    2663..2869
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    2975..3166
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cl21522"
                     /db_xref="CDD:473895"
     misc_feature    order(3170..3175,3179..3184)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(3206..3208,3380..3382,3425..3427)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3212..3421
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    order(3488..3490,3686..3688,3731..3733)
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    3491..3745
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="Fibronectin type III domain; Region: fn3;
                     pfam00041"
                     /db_xref="CDD:394996"
     misc_feature    3863..4177
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="TM proximal of protein tyrosine phosphatase,
                     receptor type J; Region: PTP_tm; pfam18861"
                     /db_xref="CDD:465889"
     misc_feature    4517..5182
                     /gene="Ptp10D"
                     /locus_tag="Dmel_CG1817"
                     /gene_synonym="10D; CG1817; CT4920; Dmel\CG1817; dptp;
                     DPTP; Dptp10D; DPTP10D; DPTP[[10D]]; Ptp10; ptp10d;
                     ptp10D; Ptp10d; PTP10D; R-PTP 10D; RPTP10d"
                     /note="catalytic domain of R3 subfamily receptor-type
                     tyrosine-protein phosphatases and similar proteins;
                     Region: R3-PTPc; cd14548"
                     /db_xref="CDD:350396"
ORIGIN      
        1 atcagattcc aattcagtgt ggtgaagagc gaaccggagt gcggacggta cggacgcgaa
       61 atctgttaag gcgggccgca aagcaaacgc tcgaaaaacg caaaatttgt cgattgtccg
      121 ttccgctttt ttcttgtgtc tgtgctttgc gtcgcgtgcc tgcgtgtacg tgtaagtgtg
      181 cgtgcgcctg tgtttgtttt ttgttatttt ttttataacc aacgacaaca acagaataga
      241 agtaaataaa atacacaaat taacggtgta tatatttaaa tgttttggtt ttttttagtg
      301 gcgtgccgaa tgagcaaaat ttgagaaaaa cgcagtggaa aaccaattgg attcaggata
      361 aaaatttaca aaatttcacc acactaacgg gaaaactgtg aaaacaatgc atttaatcaa
      421 agtaaagact aaactcgcgc taaaaatgcc cgaattcgaa agaaactagc gaaaagccca
      481 attcaaaaat cgcacaataa attgcaaagt ccaaagcaac aacaacatag gaacaaataa
      541 aacaagaagc aggcaacaaa agagagccag gcggagagga aaacaacaac gaaaacagca
      601 aaacgacggc cccaaaatgt tgtaccagct aagtaaagcc actactagaa tccggctcaa
      661 aaggcaaaaa gccgttccac aacatcgctg gctctggagt ttagcatttc tggcagcatt
      721 tacactaaag gacgttcgat gtgcagatct agccataagt atacccaata atcccggcct
      781 ggacgatggg gcctcctatc gactggacta tagtccgccc ttcggttatc cggagcccaa
      841 cacgacgatt gcctcgcggg aaatcggcga tgagattcaa ttctcacgcg ccctaccggg
      901 caccaaatac aacttttggc tgtactacac gaactttacg caccacgatt ggctcacctg
      961 gacggtgacg ataacaacgg ctcccgatcc gccgtcgaat ctgtccgttc aggtgagaag
     1021 cggcaagaat gccatcatcc tatggtcacc gcccacccag ggcagctata cggcgtttaa
     1081 gatcaaggtg ctcggactgt cggaggcgtc gagcagctac aaccgcacct ttcaggtgaa
     1141 cgacaataca ttccagcaca gcgtcaagga gctgacaccc ggagccacct accaggtgca
     1201 ggcatatacc atctacgatg gcaaggagtc ggtggcctac actagtcgca acttcaccac
     1261 aaagcccaac actccgggga aattcatcgt ctggttccgt aatgagacga cactgctggt
     1321 cctgtggcag ccgccatatc cggcgggcat ctacacgcac tacaaggtat ccatcgagcc
     1381 gccggatgcc aacgatagtg tgctctatgt ggaaaaggag ggcgaaccgc ccggaccggc
     1441 gcaggctgcc ttcaagggtc tggtgcccgg aagggcgtac aacatatccg ttcagacgat
     1501 gtccgaggat gagatctcat tgccgacgac ggcgcaatat cgaacggtgc cgttgcgtcc
     1561 gctgaacgtg acctttgacc gtgactttat tacctccaat tcgttccgtg tcctgtggga
     1621 ggcgcccaag gggatatccg aatttgacaa ataccaggta tcggtggcca caacacgacg
     1681 ccaatccaca gtgccgcgca gcaatgaacc ggtggcattc tttgattttc gcgacatcgc
     1741 cgaaccgggc aagacgttca atgtgatcgt gaagaccgta tccggcaagg ttacctcgtg
     1801 gccagccacc ggggatgtga cactgcgacc actgcccgtt cgcaatttgc ggagcatcaa
     1861 cgatgacaag acgaatacta tgatcataac gtgggaagcg gatccggcca gcacgcagga
     1921 tgagtatcgc attgtatacc acgaactgga gacatttaat ggtgacacca gtaccctgac
     1981 cacggatcgg actcgattca cactggagag cctgctaccc ggtcgcaact actcattgtc
     2041 cgtccaggcg gtatccaaga agatggaatc gaatgagact agcatctttg tggtcacccg
     2101 accctcgtcg cccatcatcg aggacttgaa gagcatacgg atgggtctga acatcagttg
     2161 gaagagcgat gtcaactcca agcaggagca gtacgaggtg ttgtactcgc gcaacggaac
     2221 cagcgatttg cgaacccaaa agaccaaaga gtcgcgtctg gtgatcaaga atctgcagcc
     2281 aggtgctggc tatgaactca aggtgtttgc agttagtcac gatttgcgca gcgaaccaca
     2341 tgcctatttc caagcagttt atcccaatcc accacgcaac atgaccatcg aaacggtgag
     2401 gagtaactcg gtgctggtac actggtcacc gccggaaagc ggtgaattta ccgagtactc
     2461 gatacgctat cgcacggaca gcgaacagca gtgggtgcga ttgcccagcg ttcggtccac
     2521 ggaggcggat atcaccgata tgaccaaggg cgaaaagtac accatccagg tgaacacggt
     2581 cagctttggc gtagagagtc cagtgcccca ggaggtgaac acgacggtgc cgccgaatcc
     2641 ggtgtccaat atcattcaac tggtggactc acggaacatt acgttggagt ggcccaagcc
     2701 agagggtcgc gtggaatcgt acattcttaa gtggtggccc agcgataatc ccggtcgtgt
     2761 ccagaccaag aatgtctccg agaacaagtc ggccgacgat ttgtcaacag tgcgtgtcct
     2821 catcggcgaa ctgatgcccg gcgtgcagta caagtttgac atccagacga cgtcgtatgg
     2881 aatcctgtcg ggcatcacca gtctgtatcc gcgcaccatg ccgctcatcc agtcggacgt
     2941 ggtggtggcc aatggcgaga aggaggacga gagggacacc atcactctga gctacacacc
     3001 cacaccgcag tcgtcgtcca agttcgatat ctatcgattc tctctcggcg atgccgagat
     3061 ccgggacaag gagaagctgg ccaacgatac ggatcgcaag gtgacgttta cgggtctggt
     3121 gcctggtcga ttgtacaaca tcacagtttg gactgtgagc ggtggtgtgg ccagtttgcc
     3181 catacaacga caggatcgcc tgtatccgga acccatcaca cagctgcatg ccaccaacat
     3241 cacggatacg gagatctcat tgcgctggga tttgcccaag ggcgagtaca atgacttcga
     3301 tattgcctat ctcacggcgg acaatctatt ggcccagaat atgaccacca ggaatgagat
     3361 caccatcagt gacctgcgac cccacaggaa ctacaccttc accgtggtgg tacgttccgg
     3421 cactgaatcg tccgtgctga ggagcagttc accattatcc gctagcttta cgaccaatga
     3481 agcggtgccc gggcgagttg aacgcttcca tcccacggat gttcagccca gcgagatcaa
     3541 tttcgagtgg tcgctgccat cgagtgaggc aaatggcgtt attcgccagt tctcgatagc
     3601 ctatacgaat atcaataatc tcacggacgc aggcatgcag gactttgagt cggaggaggc
     3661 attcggtgtg atcaagaatc taaagcccgg cgagacctat gtgttcaaga ttcaggccaa
     3721 gactgccatc ggtttcggtc cggagcggga gtaccgtcaa acgatgccga tattagcgcc
     3781 accacgtcct gccacccaag tggtgcccac cgaggtctat cgcagctcat cgaccatcca
     3841 gattcggttt aggaagaact acttctcgga tcaaaacggc caggtgcgca tgtacacgat
     3901 catcgtggcc gaggatgatg ccaagaatgc atccggcctg gagatgccca gctggctgga
     3961 tgtgcagtcg tacagcgttt ggttgcccta tcaggccata gatccgtact atccattcga
     4021 gaatcgatcc gtagaggact tcaccatcgg tacggagaac tgtgacaacc acaagatcgg
     4081 ctactgcaac ggaccactga aatcgggaac cacctatcgg gttaaggtgc gggcgttcac
     4141 cggagcggat aagttcacgg ataccgccta cagttttccc attcagacag atcaagacaa
     4201 cacctcactg attgtggcca ttacggtgcc gttaactatc atcttggtgc tcctggtgac
     4261 acttttgttc tacaaacgac gtcgcaacaa ttgccgtaag acgaccaagg attcgagggc
     4321 caacgacaat atgtccctgc cggatagcgt aatcgagcag aatcgcccca ttctgatcaa
     4381 gaactttgcc gagcactatc gcctaatgtc cgccgattcg gacttccgtt tcagcgagga
     4441 attcgaggaa ctgaagcacg ttggccggga tcagccgtgc acttttgccg atctaccctg
     4501 caatcgtccg aaaaacaggt tcaccaatat actgccctac gatcactcac gtttcaagct
     4561 tcagccggtg gacgatgatg agggtagtga ttatatcaat gccaattacg tgccgggtca
     4621 caattcaccg cgcgagttca tcgtgaccca gggaccattg cattcgacac gcgatgactt
     4681 ctggcgaatg tgctgggaga gcaactcgcg ggccatagtc atgctgacca ggtgctttga
     4741 gaaggggcgc gagaagtgcg accagtattg gccaaatgat acggtgcccg tcttctacgg
     4801 tgacatcaag gtgcagatac tcaacgacag tcactatgcc gactgggtga tgaccgagtt
     4861 catgctatgc agaggcagcg aacagcgcat cctgcgacac ttccacttca ccacctggcc
     4921 ggacttcggt gttcccaatc cgccacagac actggtgcgc tttgtgcgcg cattccgcga
     4981 tcgaattggt gcggaacagc gacccattgt ggtccattgt agcgccggtg tgggaaggtc
     5041 gggcaccttc atcaccctgg atcgcatcct gcaacagatc aacacgtctg actatgtgga
     5101 catatttggc atagtatatg ccatgcgcaa ggagcgcgtt tggatggtgc agacggagca
     5161 gcagtatatc tgcatccacc agtgcctgct ggcggtgctc gaggggaagg agaacatcgt
     5221 gggtcccgct cgcgagatgc acgacaacga gggctatgaa gatgacgagg gcattgcaga
     5281 gtcgggcatg taaagccatt ccaaaaccca atactccagc caatccaagc cagccagcca
     5341 gccaaccaag caactgaact caactcaacc gaatggaaac ccaacccaac ccaacagaac
     5401 ccaaccatct tgtggcaact acattattat ttacttaagg gacgaagtgc gaagagagcg
     5461 cggaggagga tcaacgcttg atattatact tggatatatg tgtactacac tggatactac
     5521 tggatatata tatatatata tactctacac cgcgatctat cgaatgggaa tgcagcaatc
     5581 tcgccaaaca gaacgaacac gcatcaattt atacatttta tatatatata aagatatata
     5641 tatctaagat aacgaggaat cggcgtacaa tgtaaccgca attgccgctt caaaccgacg
     5701 gcaatactaa atactggaat actgattgta tttttacgct agccacaatt tgatataaac
     5761 tatatatctt ccaatttttt tgtacaccta atgttagttg aaatatgtga gcgagacgag
     5821 caaatttttg tagcaaacta aaagcgctaa atgtttactt ttttatatta ttatatatat
     5881 aaatacttga taaacatata cctaatatta gatctaaact aaactaacta taaatcgcac
     5941 acactcatac actcacacaa aaacacaatg caataattga gttacatagt tttaaacaaa
     6001 tgttaaaaca ttttgctgca accgtcggag atgtagtgta caatttttag tttctcgtat
     6061 tatttttttt tttatgtctg ttttgtgttt aaattttttg taacttttta caaagcgtaa
     6121 actgtgtatg tatgtgctac attgattttt gtttaattat atcaagtttt tatttaaaaa
     6181 atcgaacacc accttgcatt ctcctcattt gaacgtggcg ctcacactta ttacttatat
     6241 aggtcaaata cagcgggctc tggtgatcaa tccaatcagc agaaagtaat gaaaaacacc
     6301 gaagttaatg tttaaacata aacacacaat gagaaaagag tcgtgtttcc atattcactt
     6361 gatttaatcg gcatgcgatg ttactcacag cgaaaggaaa ttcagcaagc ttgaatcgat
     6421 aaaattgttg tatatattaa atagtttaac actgtgtaat tttatttatc ctagctcgat
     6481 tctaagtgct tgcgtaaatg atcatttaaa ttttctaacc cgaaagaact tatttattgg
     6541 tttatttata caaaattgaa atgaagtgca tatggaaaca caactcaaaa acagacagca
     6601 caaatagaac aacaggaaca aatgaccaac gcatttcgaa aggcgataat catttacacg
     6661 aaaaaccaat ataattaaac agaatcccac gcaaactgaa gactaactaa caaccaagtt
     6721 aagggctagt taatggagcc ggtgccaaag caaaaaagga aaaatgataa caacacctac
     6781 acacacgaca actaaatgta acaatagcaa tacattttaa tgaaaattgt agtccaaata
     6841 atttgcatac atttgtattt tgtccaaact tagttgaaat gattaaccga actgtgaaag
     6901 agtgcaatag aaatcgtttt gcttctagat tagtgaaaaa tacaacgaag cccctaattt
     6961 gaatacgaag caacccaaaa tccccgccct cccgtaataa caataaatac atatgcataa
     7021 ttatgcaaaa gtttgagaag atgaaactag aaagtctgta taatgcatac ataatatacg
     7081 actccattat acacacacac acgcatacta aggccgatga ataacatatg catatacaat
     7141 atagacatat attaaatata tatcattgta ataatttgta atgtttatca gtagaattat
     7201 gatccgaggt ggagcagacg agtaaaacgc atgcagagat ccattaaagt gtactgtaaa
     7261 atgtgccac