Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster megalin, transcript variant A (mgl), mRNA.


LOCUS       NM_001103454           15259 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_001103454
VERSION     NM_001103454.3
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 15259)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 15259)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 15259)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 15259)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 15259)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 15259)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 15259)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 15259)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 15259)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 15259)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 15259)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 15259)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 15259)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 15259)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 15259)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 15259)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 15259)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 15259)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jul 15, 2014 this sequence version replaced NM_001103454.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..15259
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..15259
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Megalin"
                     /map="8D9-8E4"
                     /db_xref="FLYBASE:FBgn0261260"
                     /db_xref="GeneID:8674055"
     CDS             486..14795
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="CG42611 gene product from transcript CG42611-RA;
                     CG42611-PA; mgl-PA; LDL receptor-related protein 2"
                     /codon_start=1
                     /product="megalin, isoform A"
                     /protein_id="NP_001096924.2"
                     /db_xref="FLYBASE:FBpp0291363"
                     /db_xref="GeneID:8674055"
                     /db_xref="FLYBASE:FBgn0261260"
                     /translation="MNPTPVGIGFGFGRKPPSKARMRSRWRPPSATTLLTHDPANGDS
                     HTAADPLQVTDAAPSGPPSSSSSSPIGDRHSQHHSSSAIDRRLQQQQHHQSPQHHRQR
                     GQLTTLALLLLALVAISNLETLLAVRTEGPRNRHGSPGGSLASTGGSSSGINTECPTD
                     SFRCNNGKCISHHWVCNYQKDCDDGEDEMQSCPPPECETPQLNCGQYTFNKTYCIPPH
                     YRCDMIEDCEDKSDEAQCTYRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYL
                     DCRTGRDEVGCSGVACRLDQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHH
                     AQFRCTNALCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILK
                     SQLCDGKRDCEDGSDEETNCSIASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTC
                     VDLDECAEWGHCDQLCTNTLGSYTCQCAQGYTLINDSKCIAPDANNLQLIFAHDRAIM
                     RMLPHGSEPKILANATAAAGVTFHYARNTLYWSDIKTRKVQSLPLDAQNKAVSPFDQT
                     LPGTWAPVALAVDWVGDKIYVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPT
                     AGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESV
                     DYEGAHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAK
                     DIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQL
                     ETDLKLCKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVVSRRARFVGLDFDARDE
                     FIYYSDVLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVL
                     STRNVTHRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANTDGSGLLVFKNVT
                     LGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMY
                     ITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQPCHRNNGGC
                     QKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGERLADDQVSCIPDPSAEPPVQ
                     PCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGRCIPQ
                     NFRCDQENDCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDF
                     CAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQ
                     CVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDC
                     SDHSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKC
                     PHGQWQCPGVSERCVNITSVCDDTPDCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPN
                     GALCVCPPGSEIGEDGYTCIDSNECDPPGLCSQQCTNTKGSYFCSCTDGYVLEPNKHT
                     CKAVNHTAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKL
                     KKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVL
                     VRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLT
                     LDIATKRVYFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQL
                     NRVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMTPNPCAGSRCQHLCLLSPSAP
                     EGYSCKCRPGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIES
                     STGLDFDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGIENGIVGAPYTIAFD
                     WLGRNLYIGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIALDPTEGKLFW
                     IDEGVLEVPIKIGRVDMNGQNPIVVFQEFAHPESLAVDTEKKMVYYSASNPAVIGVMD
                     YNGDDHTLILMKDSHPMAKPRSLGILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNE
                     SDLRSMMIYKKRALMQHPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEINCVAYK
                     IFAVVSQLDMIRGYSLSDSSEAMVPISGPGHHILHVDVMYREQWIYWAEYNRGYWNGI
                     FRSRPNGTDLQHVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRK
                     VLVKTTTDAPRELAVNPIKRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLT
                     IDMQTHDIYWVDSKLDTIQKISYNGANRKIIRRDLPNPMGIAVYLNDVYWVDRNLMTV
                     FKASKHSANETATSVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPP
                     DGGASGTSGGRNFRCECATGKLSADERKCEVVNEYLVFATRTEIRAVNLDPHSTEVPF
                     TPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGHDDITVVLNKGINPEGI
                     AYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLDPCNGTLFFTDWGRF
                     GTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIERSDLDGQN
                     RELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKRLEDSPRDIRI
                     YSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEA
                     SKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKC
                     DHENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDETHERC
                     PMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNH
                     RCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDC
                     LDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTT
                     LHNCATQQPCGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFT
                     CQNFKCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYP
                     DCADESDEPAHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDE
                     CLEQPGACSQHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNM
                     SVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAV
                     IRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVVDPRAIVVHPG
                     IGYLYFTSWHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLD
                     YIAYADLEGRHRHTVLSGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVL
                     RNTTHRPYDLHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAP
                     IFKCACPNQFYLARDMKTCVANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPA
                     TCAPRHCRAGTFQCKNTNCTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRC
                     ILDSWRCDGDADCKDGSDEDPAVCFKRTCDPKTEFSCKNGRCIPQLWMCDFDNDCGDD
                     SDEPAYMCRQRNCTTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCNPE
                     TDFKCGNNRCIPKQWMCDFADDCGDASDENEAVCKGRYRECSESEFRCGNGKCISSRW
                     QCDHEDDCGDNSDEMHCEGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPP
                     RFPGGRYCPESRFQCNNNLCVSLSDLCDGTDDCGDGSDEDPSVCSDFNCDTLRRFQCS
                     NERCVARYQICDGVDNCGDGSDENNMTLCASKQKPCDLYTQYQCANKHCIERSQVCDF
                     SDDCGDASDELGCHHTSSCSEANRGGCQQHCHNLTDGGYICTCYPGYIIAADNKKKCS
                     DVDECLTRQHTCSHQCHNLNGTYSCSCREGFHLTDGASGVCRAEKEDVILLFVNGQEI
                     RGLNWHKSEEFAVIAAEKRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIG
                     FAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRYRRSIVNAG
                     LEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEMIRHPAGLTIDYSQD
                     HIIYWVDTKLNAIESMRADGSRRKAIVRGDQLRHPVSLDLFESNMFWMTRDTGELVRQ
                     DKFGRGVQVVLHRYIVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLLVPGGHRCACP
                     DASGPPPSHRSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELLCECRTQFVGE
                     HCETSTMGAFGHGDANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARMPAMTSS
                     QSVTFRHGSNVEFNESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYDAVQS
                     GTTADPGMGNGSGIYDVPGEPSAKVKSMGHHAGGSFTEPASAIIAPSSITHKASPQLQ
                     LRTRELDPSADTGKDTQFLVEEDKSEC"
     misc_feature    954..1052
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(969..971,993..995,1026..1031)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1005..1007,1014..1016,1026..1028,1044..1049)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1035..1049
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1095..1193
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1110..1112,1128..1130,1161..1166)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1140..1142,1149..1151,1161..1163,1179..1184)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1170..1184
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1359..1466
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1374..1376,1401..1403,1434..1439)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1413..1415,1422..1424,1434..1436,1452..1457)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1443..1457
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1479..1583
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1494..1496,1518..1520,1551..1556)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1530..1532,1539..1541,1551..1553,1569..1574)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1560..1574
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1596..1721
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1611..1613,1653..1655,1686..1691)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1665..1667,1674..1676,1686..1688,1704..1709)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1695..1709
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <1824..1949
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:469594"
     misc_feature    <1959..2387
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="DNA-binding beta-propeller fold protein YncE
                     [General function prediction only]; Region: YncE; COG3391"
                     /db_xref="CDD:442618"
     misc_feature    2202..>2633
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    2202..2315
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2331..2447
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2454..2564
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2772..2900
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    3045..>3461
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Sugar lactone lactonase YvrE [Carbohydrate
                     transport and metabolism]; Region: YvrE; COG3386"
                     /db_xref="CDD:442613"
     misc_feature    3249..3377
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    3402..3506
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    4047..4154
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(4065..4067,4089..4091,4122..4127)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4101..4103,4110..4112,4122..4124,4140..4145)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4131..4145
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4164..4262
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4182..4184,4206..4208,4239..4244)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4218..4220,4227..4229,4239..4241,4257..4262)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4248..4262
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4287..4394
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4302..4304,4329..4331,4362..4367)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4341..4343,4350..4352,4362..4364,4380..4385)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4371..4385
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4407..4514
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4422..4424,4449..4451,4482..4487)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4461..4463,4470..4472,4482..4484,4500..4505)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4491..4505
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4551..4646
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4554..4556,4581..4583,4614..4619)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4593..4595,4602..4604,4614..4616,4632..4637)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4623..4637
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4656..4754
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4674..4676,4698..4700,4731..4736)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4710..4712,4719..4721,4731..4733,4749..4754)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4740..4754
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4788..4892
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4806..4808,4836..4838,4869..4874)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4848..4850,4857..4859,4869..4871,4887..4892)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4878..4892
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5049..5144
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    5358..5480
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5484..5618
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5553..5672
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    5619..5747
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6441..6596
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6936..>7022
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    7260..7400
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7461..7583
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    7539..7661
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8220..>8618
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    8262..8351
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8385..8519
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8496..8624
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    9084..9188
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9099..9101,9123..9125,9156..9161)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9135..9137,9144..9146,9156..9158,9174..9179)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9165..9179
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9201..9308
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9216..9218,9240..9242,9273..9278)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9252..9254,9261..9263,9273..9275,9297..9302)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    order(9282..9287,9294..9302)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9333..9434
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9348..9350,9375..9377,9408..9413)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9387..9389,9396..9398,9408..9410,9426..9431)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9417..9431
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9585..9683
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9603..9605,9627..9629,9660..9665)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9639..9641,9648..9650,9660..9662,9678..9683)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9669..9683
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9723..9830
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9732..9734,9774..9776,9807..9812)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9786..9788,9795..9797,9807..9809,9825..9830)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9816..9830
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9867..9962
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9882..9884,9906..9908,9939..9944)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9918..9920,9927..9929,9939..9941,9957..9962)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9948..9962
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9993..10097
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10008..10010,10032..10034,10065..10070)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10044..10046,10053..10055,10065..10067,10083..10088)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10074..10088
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10113..10211
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10131..10133,10155..10157,10188..10193)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10167..10169,10176..10178,10188..10190,10206..10211)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10197..10211
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10260..10346
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10362..10472
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10569..10667
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10701..10829
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10887..11018
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    10977..11093
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11091..11219
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11304..11462
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11472..11573
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11487..11489,11517..11519,11550..11555)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11529..11531,11538..11540,11550..11552,11568..11573)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11559..11573
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11598..11702
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11613..11615,11637..11639,11670..11675)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11649..11651,11658..11660,11670..11672,11688..11693)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11679..11693
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11712..11810
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11727..11729,11754..11756,11787..11792)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11766..11768,11775..11777,11787..11789,11805..11810)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11796..11810
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11835..11936
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11856..11858,11880..11882,11913..11918)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11892..11894,11901..11903,11913..11915,11931..11936)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11922..11936
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11964..12068
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11979..11981,12012..12014,12045..12050)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12024..12026,12033..12035,12045..12047,12063..12068)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12054..12068
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12096..12188
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12108..12110,12132..12134,12165..12170)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12144..12146,12153..12155,12165..12167,12183..12188)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12174..12188
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12222..12326
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12237..12239,12261..12263,12294..12299)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12273..12275,12282..12284,12294..12296,12312..12317)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12303..12317
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12339..12443
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12354..12356,12378..12380,12411..12416)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12390..12392,12399..12401,12411..12413,12429..12434)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12420..12434
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12471..12566
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12486..12488,12510..12512,12543..12548)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12522..12524,12531..12533,12543..12545,12561..12566)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12552..12566
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12612..12698
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12612..12614,12636..12638,12669..12674)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12648..12650,12657..12659,12669..12671,12687..12692)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12678..12692
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12741..12836
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12747..12749,12771..12773,12804..12809)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12783..12785,12792..12794,12804..12806,12822..12827)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12813..12827
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12972..13067
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(12972..12974,12981..12983,13023..13025)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    13311..>13763
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    13356..13493
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    13533..13658
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    13605..13736
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    13611..13751
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
ORIGIN      
        1 cgtcgtcgtg aacggtcagc cagcgcggct aataagtaac caactgtagt gacagtgcga
       61 tagtgactct gatccgaacc cgaatcccag gcccacaaca gatacgtcca gcgtgtgggc
      121 agccagaaca gagtgacaag aatatcggag ccgacaacaa cagtaaactg aaagatagaa
      181 agaaagaaag aaaggccaac ctgccgatta aattccaatt gagtgttacg agtttttttt
      241 tcgacccacc aaaagaaaaa aataaatatt ccaaaaagta aaacgcaaca aagccagagg
      301 agcgggcaac cctaaaaaag acagaagtgc ggtgggcaga gaagaggtca ccagagggtc
      361 accaaaaaaa acaaaaaaaa accgaaacga acaagaccca aatccgaatc gaggattccc
      421 acagaaacca aacaggaaaa ggagaaagga gcggagcagc aagcgaagcg cccgacgaac
      481 caaaaatgaa tccgacgccc gtgggcattg gattcggatt tggtcgcaag ccgcccagca
      541 aggccagaat gcgttctcgc tggcgaccac catcagcgac aaccctgctg acccatgacc
      601 ccgccaacgg cgacagccat acggccgccg atccgctgca ggtcactgat gccgccccat
      661 cgggcccacc atcatcttca tcatcctcgc ccatcggcga ccgccattca cagcatcaca
      721 gcagcagcgc catcgatcgg aggctgcagc agcagcagca ccaccaatca ccgcagcacc
      781 atcgtcagcg cggccagttg acaaccctgg cgctgctgct actggccctt gtggccatca
      841 gcaacctgga aaccctgctc gccgtgcgca ccgaaggacc gcgcaaccgt catggatcac
      901 caggtggcag cctggccagc acaggtggca gcagcagtgg catcaacacg gagtgtccaa
      961 cggactcgtt tcgatgcaac aatggcaagt gcatctcgca ccactgggtc tgcaattatc
     1021 aaaaggactg cgacgatggc gaggatgaga tgcagtcgtg ccctccaccg gaatgcgaaa
     1081 cgccgcagtt gaattgcggg cagtacacgt tcaacaagac ctactgcatc cctccgcact
     1141 atcgctgcga tatgatcgag gattgtgagg acaaatcgga tgaggcgcag tgcacgtacc
     1201 gcaagtgcca gcacacggac ttgttttgca acacgcccac tggagcaccg gcggagggcg
     1261 cccgcctcac cggaccctgt gtgcccaagg agaagcgctg cgacggctac ttggactgcc
     1321 gcaccgggcg ggatgaggtc ggctgcagtg gcgtagcctg tcgcctcgac cagttccgct
     1381 gtgccaacgg actcaagtgc atcgacgccg ccctgaagtg caatcaccgc gatgattgtg
     1441 gcgacaactc tgacgagcag ggatgcaact tcccgccatg ccaccacgcc cagttccgtt
     1501 gcacgaacgc actgtgcata ccgtacaact ttcattgcga tggctaccac gactgcgccg
     1561 acaagagcga cgaggccaac tgcacggcca tcgcctgtcc ggacaacaag cacctctgtc
     1621 cacgtggcgg cgccagcggc acgcccaagt gcatcctgaa gtcgcaactc tgcgacggca
     1681 agcgggactg cgaggatgga agcgatgagg agaccaactg ctctattgcc tcatgccccg
     1741 ccctgagctg tgagttcaaa tgcggaccct cgctgacggg tggagtgtgc tactgtaagc
     1801 cgggccaatc gctggctcct gacaaccgga cctgtgtcga cctggacgag tgcgcggaat
     1861 ggggtcactg cgaccagctg tgcaccaaca cactgggatc gtatacatgc caatgcgccc
     1921 agggctacac gctcatcaac gactccaagt gcatagctcc ggatgcgaat aacttgcaac
     1981 tgatattcgc ccacgatcgt gccatcatgc gaatgctgcc gcatggcagt gagcccaaga
     2041 ttttggccaa tgcaactgcc gcggcgggtg tgaccttcca ttatgcccgg aacacactgt
     2101 actggtcgga catcaagacg aggaaggttc aatcactgcc gctggatgcg cagaacaagg
     2161 ccgtctcgcc cttcgatcag acccttcccg gcacctgggc gcccgtcgct ctggccgtcg
     2221 actgggtggg cgataagata tatgtggcgg atttggtggg tcagaagatc gatgtcttcg
     2281 agctgagtgg tcaatggcat gcggttgttc tgggctctaa tctcacctca cccgccgatc
     2341 tggcactgga tcccacggct ggtctaatgt tcgttgcgga tggcggtcag gtgctccgtg
     2401 cccatatgga tggcacacat gccagatcga ttgtctcgga ggcggcctac aaggccagcg
     2461 gtgtgacggt ggacattatc agcaagcgtg tcttctggtg cgactccctg ctggactaca
     2521 ttgaatccgt ggactatgag ggtgctcatc gggtgatggt gctcaggggt caacaggttc
     2581 cgagtccctc gcgattggct ctgttcgaga atcgtatcta ctggacggat gccaccaagc
     2641 agggcatcat gtcggtggac aagttcgagg gtcccacctc cattcaggtt acgtacaagg
     2701 ccaaggacat cagggagccg aagggcatca ttgctgttca tgcgctcagc cagcccagag
     2761 tatcgaatcc ctgtggcaac aacaacggtg gctgcaatca catgtgcatt gtgaccgccg
     2821 taaagggagc acccactggc ctgggattcc gttgtgcctg ctccacgggc taccagctgg
     2881 aaacggatct gaaactatgc aagccagtca gtgaattcct catgtactcg cagcagagat
     2941 tcatcaaggg aaaggtattg gaaccggtaa ttgaaggatt tagtgatgcc atcatgccgg
     3001 tggtttcgag gcgtgctcgt ttcgtcggtc tggatttcga tgcacgcgat gagttcatct
     3061 actactcgga tgtgctgcag gatgtgatct acagggtgca ccgaaacgga actggccggg
     3121 agatcgtctt ggcctctcag aatgaaggcg ttgagggact ggccgtcgat tgggcctcca
     3181 agaatctgta ctacatcgat tcgcgcaagg gcaccttgaa cgtcctatcc acccgaaatg
     3241 tgacacacag aagaacccta ctgaaaaacc tgaaacgtcc cagggccatt gtggtccatc
     3301 ccaatcgtgg tttcatcttc ttctccgaat gggaccgtcc tgcgaatatc accagagcaa
     3361 acacagatgg tagtggtttg ttggtgttca aaaatgtaac cctcggctgg ccaaatggac
     3421 tatccatcga cttcaaggag gatcgtgtct actggtgcga tgctctattg gatcacgttc
     3481 agcatgccaa cctggatggc acggatatta agacggtgaa ctcacgactg gtgcgacatc
     3541 cgttctccat tgtcattcac aacgattgga tgtatatcac ggactggcgc ctggatgcca
     3601 ttatacgttt gcacaagctt acgggcgagc aggaggagat gatggtcaga gagccgcaga
     3661 ccaatagact gtacggcgtt aaggtgtaca gtcatgaggt ccagaggatc gcggacacgc
     3721 aaccttgtca caggaacaat ggtggctgcc agaagatctg tttcgctgtt cccatcggag
     3781 catcaaatgg taccgatggg gtgaccactt cgtcgccctc gttcggtcgc ctacagtcgc
     3841 gctgctcgtg tccctatggc gaacgattgg ccgacgacca ggtgagctgc attcccgatc
     3901 ccagtgccga gccaccagtg caaccctgcc cgaactcatg ggactttacg tgcaacaatc
     3961 agaggtgtat tcccaagtcg tggctatgcg acggtgatga tgactgtctg gataacagtg
     4021 atgaggagca gaactgcaca aagcccactt gcggatccaa cgagttccag tgtcgatcgg
     4081 gtcgctgtat tccgcagaac ttccgttgtg accaggagaa cgattgcggt gacaactccg
     4141 atgagcagga gtgcggcaat gtgacctgtg gaacgtccca gtttgcctgt gccaatggac
     4201 gctgtattcc caatatgtgg aaatgcgata gcgagaacga ttgtggggat agcagtgatg
     4261 agggtgactt ctgtgccgaa aagacctgcg cctatttcca gttcacgtgc ccgcgaacgg
     4321 gtcactgtat tccacagagt tgggtttgtg acggcgacga tgattgcttt gacaaacagg
     4381 acgagaagga ttgtccaccg atatcctgtc tggcgaatca attcaaatgc gcggatctaa
     4441 ggcaatgtgt agaggagtcc tacaaatgtg atggcatacc ggactgtaat gatggctccg
     4501 atgaggtggg ctgtccttcc atgggaccaa atcagtgtaa cctggagaag cacttccgtt
     4561 gcaagtccac tggcttctgt attcccatcg cctggcactg tgatggctcc aatgattgtt
     4621 cagatcattc ggatgagcag gattgtggtc agatcacctg tgcccagaac ttcttcaagt
     4681 gcaacaacac gaactgtgta tttaaggcat acatatgcga tggcaaggac gattgcggtg
     4741 ataattcgga tgagggagct gaacacgcat gtgtcccacc cccgttcaag tgtccccatg
     4801 gtcagtggca gtgtcctggc gtttccgaga gatgcgtgaa catcacatct gtctgtgatg
     4861 atacgcccga ttgtcccaat ggttcggatg agggtgaggg ctgcgatttg gccgagtgcg
     4921 aacatcaggc gggtcagtgc tctagcttct gtcagaagac ccccaacggt gcgttgtgtg
     4981 tgtgtccacc tggttcggag atcggcgaag atggctacac ctgcatagat agcaacgagt
     5041 gcgatccacc gggtctctgc tctcagcaat gtaccaacac caagggctcc tacttctgct
     5101 cctgcacaga tggctatgtt ctcgagccga ataagcacac ttgcaaggca gtaaaccaca
     5161 ccgccgcctt cctaatcatc tcaaatcgtc actccattct tgtggcagat ctcaaggaac
     5221 agggactcga gagggtgccc atcatagtgg aaaatgtggt ggccactgct tccaatatgc
     5281 acacaggcac tattttctgg agcgacatga aactaaagaa gatctcccga ttagatcgcg
     5341 gtatggagcc acaggaaatc attaacacgg gcctagactt ggtcgagggc ctggcctatg
     5401 attggattgc ccagaatctc tactggctgg acagcaaact gaacaccatc gaagtgtccg
     5461 cggagaacgg ttccaatcgt ctggttttgg tcagggaaaa catcacccaa ccaagaggca
     5521 tgtgcatcga tcccagtccc ggagcaagat ggatcttctg gactgactgg ggagagaacc
     5581 caagagtgga gagaattggc atggatggta ctatgagaaa aacgatcatc aataccaaga
     5641 tctactggcc caatggctta actttggata tagcaacaaa gagggtttac tttgccgact
     5701 ccaagctgga ctttattgat ttctgctact acaacggcac cggtagacag caagtcctgg
     5761 ccagtagtca ctatctgctg catcctcact cgttgtcctt gttcgaggat acgctctact
     5821 ggaccgacag gcaattgaat cgagtgttgt ccgccaataa gttccgtggc aagaatcaga
     5881 ccgtcgtttc ccacctgata agtcaaccct tgtccatcca cgttcatcac gcttccctgc
     5941 agcccatgac tccgaatccc tgcgccggat cacgctgcca gcacttgtgt ctgctgagtc
     6001 ccagtgcccc ggagggttac tcctgtaagt gcaggccggg ctttaagctc ctgagcgaag
     6061 gtcgttgcat cgaggaggag aatcccttcc tcatggtcgt caagggtaca caaattgtgg
     6121 atcttccttt gaatggtggc gatgcgagag ccggagctct ggccccagtt attggaatcg
     6181 aaagcagcac gggcttggac tttgatcgca aaggagagac gctctactgg gtgcagggca
     6241 gggaggatga tgatgagaac tgcaccatct atacgacacc ctatggtggt ggcaataaga
     6301 cactcttcct gggtatcgaa aatggaattg tgggtgcacc ctacaccatt gcattcgatt
     6361 ggctgggcag aaatctttac attggcaacc gggtggccag caacattgaa gccgtgcgcg
     6421 tggatggcaa gcaaaagtat cgcaccataa tcctggccaa cgatggttat cccaactccg
     6481 tgtcgcggcc caaacaaatt gcactagatc ccaccgaagg taagctcttc tggatcgacg
     6541 aaggagttct ggaagtgccc attaaaattg gcagagttga tatgaatgga cagaatccca
     6601 ttgtagtctt ccaggagttt gcccatcccg aatcgttggc cgtggacacg gagaagaaaa
     6661 tggtgtacta cagtgctagc aatccagcgg tgatcggtgt catggactac aatggtgacg
     6721 atcatacact gatcttgatg aaggactcgc atccgatggc caagcccagg agcttgggca
     6781 tcctagacca taggctttac tacctggatc cgttgtacga gcgtattgtg aggattgatc
     6841 tgccgcacgg tgataatccc aagaccattg tcgacaacga gtccgatctg cggtcgatga
     6901 tgatctacaa gaagcgcgcc ctgatgcaac atccctgcca gacgaacaac ggtggctgca
     6961 agcacctttg cattcccgga cctggtgcaa ccagaacgtg tgcctgcggc attggataca
     7021 gaaaggaaaa cgagatcaac tgcgtggcgt ataagatctt tgccgtggtc tcccaactgg
     7081 acatgatcag gggctatagc ttgagcgata gctccgaggc gatggtaccg ataagcggac
     7141 ctggccacca cattctccat gtggatgtga tgtatcgcga gcaatggatc tactgggcgg
     7201 agtacaatcg tggctactgg aatggcattt tcagatcgcg acccaatggc accgatctgc
     7261 agcatgtggt caaggatggc atcggcagta atggcatcag gggtttgacc atcgattggg
     7321 tggccggcaa tatgtacttc accaacgtct atccccatga gaattatgtg gaagtttgct
     7381 ggctggatgg tagcaatagg aaagtgttgg tgaagacaac cacagatgca ccacgtgaac
     7441 tggccgtgaa tcccattaag aggctactct attggatcga ctatggccag catcctagga
     7501 ttggaaaagc cctcttggat ggcagcaaat ggacaccact ggtgacatcg ggcatttcgt
     7561 tgcctcgcga tctaaccatt gacatgcaga cccatgacat ctactgggtg gactcgaaac
     7621 tggacaccat tcagaagatt tcgtataatg gcgccaatcg caagataatc cgcagagatc
     7681 tgcccaaccc catgggcatt gctgtctatc tgaacgatgt ctactgggtg gataggaatc
     7741 tgatgaccgt gttcaaggcc tccaagcata gtgccaatga aactgccacc agcgtgagaa
     7801 cgaatctgga aaagcttagg gacatcgcca tatacaacat caacaatcag ccgcaggacg
     7861 atacaaatcc atgtgcgcat ttaggaaacg gtggctgtga tcagttgtgt ttcagtttcc
     7921 caccggatgg cggagcctcc ggtacctcag gaggaaggaa tttccgttgc gaatgtgcca
     7981 ctggaaaact gagcgccgat gaaagaaagt gtgaggtggt caacgagtac ctagtcttcg
     8041 ccacaagaac tgaaattcga gctgtcaatc ttgatcccca ttccacggaa gttcccttca
     8101 ctccactgac aaatctcaca aatgtcgtgg gtctggactt tgattttgcc cacaaccgaa
     8161 tgctgtatac ccaaatccgt ccgtgggcca agattgcgta caccaaggcg aataagccgg
     8221 ggcacgatga catcactgtg gtcctgaaca agggcattaa tcccgagggc attgcctacg
     8281 attggaccca gcagaaaatc tactggactg atagctcgaa caactcgatc tatgccatga
     8341 atttggatgg tagcgaactg gttatgattg cccgcgttga aagaccgcga gctattgtcc
     8401 tcgatccctg caatggcacg ctattcttta cggattgggg caggttcggt acgtctggca
     8461 agattttccg caccaccatg gcgggttccc tgaagagagc cattgtcgac aaggatcttt
     8521 cgcagccaag tggcttggct atcgattatg atgagagacg cctatactgg acggatgcgg
     8581 tgagagagaa gatcgagaga tccgatctgg acggtcagaa tcgagagctt ctggtggcag
     8641 ccaccattta tccgttcgcc ataaccgtgt tcaggaacta catctactgg acggatcttc
     8701 agctgagagg tgtctatagg gctgagaagc acactggagc caacatggtg gagatggtga
     8761 agcgattgga ggattctccg cgagatattc gcatctacag ttccgatcgc caaaagtgca
     8821 atgtgaatcc gtgcaggatc aacaacggcg gatgtgccca gagctgtcat cctgccccga
     8881 atggcaaggc cgagtgcaag tgcgacgata gcaccaaggt ggtgaacgag ggaaggatgt
     8941 gtgccccgcg aaacaatact tgcgaggcca gcaaattcta ctgcaagaac ggcagatgca
     9001 tttcgagaat gtggtcctgc gatggcgacg acgactgtgg cgacaactcc gacgaggatc
     9061 ccaactattg tgcctatcac tcctgctccc ccaacgagtt ccgctgcaac aacggacgct
     9121 gcatctttaa gtcgtggaag tgtgatcacg agaacgactg caaggatggt tccgatgagc
     9181 tgggctgcgt ctatccacca tgtgtggatg gtgagttcac ttgcgccaat ggacggtgta
     9241 ttccacaggc tcaggtgtgc aatggtgtga atgactgcaa ggataatgcc acatcggatg
     9301 aaacgcacga acggtgtccc atgaacacca cttgtccggc gaatcatctg aagtgcgaga
     9361 agaccaacat ctgcgtggaa ccctattggt tgtgcgatgg cgacaacgat tgtggtgaca
     9421 actccgacga ggatccactg cattgtggcc aacgaacttg tccaaccaac agtttccggt
     9481 gtcccaacca ccgatgcatt ccagctacct ggtactgtga tggtgacgat gactgtggcg
     9541 atggagccga tgaaccacca gattactgca aatcggaagg acgcacatgc ttcggggatc
     9601 tgttcacctg cgacaatggc aactgcatac caaggatcta catctgcgat ggcgacaacg
     9661 attgtttgga caacagtgac gaggataacc ggcaccagtg caatgaccgt aagtgtgatg
     9721 aggaaacgga gttcacttgt gtggagaaca aatcctggca gcgtgcccag tgcataccca
     9781 aaaaatggat ctgcgatggt gatccggatt gcgttgacgg agccgatgag aatactactc
     9841 tgcacaattg tgccacccag cagccctgtg gcgaggatat gttcacctgt ggcaatggac
     9901 gttgcatcaa taagggatgg atctgtgacc atgacaacga ttgcggcgat ggtaccgatg
     9961 aaggcaaatt ctgtaactcc aagtacaaga cctgttcggc ccaggagttc acctgccaga
    10021 acttcaagtg catccgaaat caatcccggt gcgatggcga agacgactgc ggtgatcact
    10081 cggatgaggt gggctgtgcc aaggagaaca taacctgtcc acagggtcag ttcgcctgta
    10141 cgaatggtca gtgcatcgac tacaatctgg tgtgcaacaa gtatccggat tgtgccgacg
    10201 agtccgacga acctgcccat tgcaacgtgg atgagtgcgc caaggtggag atcaatcagt
    10261 gtggccacaa gtgcgtggac acgctgacag gttactactg cgactgcaat gagggctaca
    10321 aactgctagc cgatggcaaa gcctgtgcgg atgtggatga gtgcctagag cagccgggcg
    10381 cttgttctca gcactgttcc aataccccgg gtggattcta ctgcaagtgc gacgagacct
    10441 actacgaaag gcagaacgat gagcacacgt gcaagcgtaa ggacaagatc ccaccgtggc
    10501 tgatcttcac caacaagtac tatgtgcgca atatgtcggt ggatggacat cagtacaatc
    10561 ttatgcacca ggatctgatg aatgtggtgg ctctcgactt cgatatacgc gaggaataca
    10621 tgtacttctg tgatgtcacg gccaagacca tcttcagagc gaagtatgga gaggccgatg
    10681 acgagatgcc gccggagagg gaggctgtca tcaggcacga ttcccatggc ctggagggca
    10741 tcgccatcga ttgggtgggt cgcaaactgt actggctgga caggcactcc aagaacctgg
    10801 atgtctccga attggacggc agcaagcgca agacactgag aagtggcgtc gtcgatccgc
    10861 gtgccatcgt cgtgcatcct ggtatcggtt acctgtactt cacctcctgg catctgcaag
    10921 cctatattgc caaaatgggc atggatggtt cgaacttctc gagaattcta aactggaacg
    10981 atggcatcgc ctggccgaat gctctgtcca ttgattactt cacggatcga atttactggg
    11041 cagatgctca cttggactac atagcatatg ctgatctgga gggcagacat cgtcatacgg
    11101 tgctctcagg aagcaaggtg cctcatgtgt tcgcactgag tctcttcgac gactacatct
    11161 actggagtga ctggaattta aaggcgatcg tgagggccaa caagttccat ggtgcgaact
    11221 atacggtgct gaggaatacc acccatcgac cgtatgacct gcacatcaat catccgctga
    11281 gacagttgcc ctacaccaat ccgtgtggca caaacaatgg cggttgctca catctctgcc
    11341 tgattgctcc gccgccggaa tccacctatc tgaacatcga gggatatatc gaggagggtg
    11401 caccaatctt caagtgtgcc tgtcccaatc aattctattt ggccagagac atgaagacct
    11461 gcgtggccaa ctgtacggcc ggacagcatt tgtgtggcgg acgagatgag aagtgcatcc
    11521 catggttctg gaagtgcgac ggtgagaagg actgcaagga tggctccgat gagcccgcta
    11581 cctgcgctcc tcgacactgc cgtgctggaa cgttccagtg caagaacacc aactgcacac
    11641 catcggcgac catttgcgat ggagtggatg actgtggcga tcgcagcgat gaacaaaatt
    11701 gcgatctacc ctgtccacta tccgatttca agtgcaagtc cagcggcaga tgcatcctcg
    11761 atagttggcg ctgcgatgga gatgccgact gcaaggatgg cagcgatgag gatccagccg
    11821 tctgcttcaa gcgaacatgt gatccgaaaa ccgagttctc ctgcaagaat ggccgctgca
    11881 ttccgcaatt gtggatgtgc gatttcgaca acgattgtgg cgacgactcc gatgagccgg
    11941 cgtatatgtg ccgtcaaagg aactgcacca ccggctggca gaggtgtccc ggccagtcca
    12001 actatcgctg cattccgaag tggctgttct gcgatggcaa ggacgattgt cgcgacaaca
    12061 gcgatgagct gcccgagaac tgtcccaagt gcaatccgga aacggacttc aagtgcggca
    12121 acaaccgatg catacccaag caatggatgt gcgatttcgc ggacgattgt ggcgatgcca
    12181 gtgacgagaa tgaggcagtg tgcaaaggac gctatcggga gtgctccgaa tcggagttcc
    12241 gttgcggcaa tggcaagtgc atatcatccc gctggcagtg tgaccacgag gacgactgtg
    12301 gcgataactc ggacgagatg cactgcgagg gataccagtg caagaatggc accttccagt
    12361 gcgcttccgg tcactgtatt gcctcctact tccggtgcga tggcgatcgc gactgccgcg
    12421 acatgtccga tgaggtgggc tgtccgccca gattccccgg cggtcgctat tgtcctgaat
    12481 cgcgtttcca gtgcaacaac aacctgtgcg tttcgctgtc cgatttgtgc gacggcaccg
    12541 atgattgcgg cgatggcagt gacgaggatc ccagcgtttg cagtgacttt aactgcgata
    12601 ccctgcgacg attccagtgc tccaatgagc gctgcgtggc ccgctatcag atctgcgatg
    12661 gcgtggacaa ctgcggcgat ggcagcgatg agaacaacat gaccctatgt gccagcaaac
    12721 agaagccctg cgatctgtac acgcagtacc agtgtgccaa caagcattgc atcgagcggt
    12781 cccaggtgtg tgatttctcc gacgattgtg gcgatgctag tgatgagtta ggatgccacc
    12841 acacgagcag ttgctccgaa gcgaatcggg gtggatgcca gcagcattgc cacaatctaa
    12901 cggatggtgg atacatttgc acctgctatc cgggctacat catagccgcc gacaacaaga
    12961 agaagtgctc cgacgtggac gaatgcctga cgcgacagca cacgtgctcc caccaatgcc
    13021 acaatctgaa tggcacctac tcgtgcagtt gtcgcgaagg attccatctg acggacggcg
    13081 ccagcggcgt atgccgtgcc gaaaaggagg atgtcattct cctgtttgtt aatggtcagg
    13141 agatcagagg tctgaattgg cataagagcg aggagttcgc tgtgatagcg gcggagaaga
    13201 ggatcgaggc actggactac gatgcgcagc aacagatcgt cttctgggcg gatagctatg
    13261 acaagaccat caagcgatcc tacatggtca atgccatcga tggcagggcc aagatcggat
    13321 tcgcccagga cctgaacatg aagggcggct cgaagcccac tgctgtggct gtggactggc
    13381 tggcctcgaa tctctactgg accgaaatgg acaggacggg ctcgaagccg cgtggacgtg
    13441 tcatggtggc caagaccgat ggtcgctatc gtcgctcgat cgtgaatgct ggactcgagg
    13501 tacccacctc gattgctgtg aatccgcagc tgggcagaat atactggtcg gatgcgggat
    13561 cagctcccaa aatcgaggta tcctggatgg atggctctaa gcgccgccca ctgatcaccg
    13621 agatgatacg acatcccgcc ggcctgacca tcgactactc gcaggatcac atcatatact
    13681 gggtggacac caagctgaat gccatcgaat cgatgagagc cgacggctcg cgccgaaagg
    13741 ccattgtgcg gggcgatcaa ctgaggcatc cggtgtctct ggatctcttc gagtcgaaca
    13801 tgttctggat gacccgcgat acgggtgagc tggtgcgcca ggataagttc gggcgcggag
    13861 tgcaggtggt gctgcatcgc tatatcgtca atccgtccgg cctgaaggtg taccacgaca
    13921 agcggtacaa cacctcgctg cccaatccgt gcgacaactc cacctgctcc cacctgtgcc
    13981 tgctggtgcc gggcggccat cgttgtgcct gtccagacgc ctctggaccg ccgccctcgc
    14041 accgcagcac cgccgaggtc atctgcaatg ctgccgccga gcatccgcgc ccggctccgc
    14101 gaatctgccc ctgccagaat ggtggactct gcaaggagga cgcccagggt gaactgctgt
    14161 gcgagtgccg aacccagttc gttggcgagc actgcgagac aagcacgatg ggagcctttg
    14221 gccatggtga cgctaatgtc accgccgtcg tggtgcccat catggtcatc ctgctggtga
    14281 tgatggccgc cgctggcgcc tggtatgtca tccgcaagcg accatttggc aagctggctc
    14341 gcatgccggc gatgacctcg tcgcagagcg tgaccttccg tcacggttcg aatgtggagt
    14401 tcaacgagag cggcttccca ggagcatctg cgccgggagc tggcgatgtg gcgcccatcg
    14461 agggctacaa cctgcagacg gtgaacgcga acaaggcgcg cgactttgcc aatcccatgt
    14521 acgatgcagt ccaatcgggc accaccgccg atccgggcat gggcaatggt tcgggcattt
    14581 atgatgtgcc cggcgagccg tcggccaagg tcaagtccat gggccaccat gcgggcggtt
    14641 cgttcacgga acccgcctcg gcgatcatcg cgcccagcag cattacgcac aaggcgtcgc
    14701 cgcagctgca gctgcgcacc agggagctag atccttcggc ggacaccggc aaggacacgc
    14761 agttcctggt ggaggaggat aagtccgagt gctgatatca agcccgtcaa tcggctgtcg
    14821 ttgcggcggc agttgcgatg gccagttgcc gccaacagcg ccggcagcat cagcagcagc
    14881 agcatcccga gaacagctat ccgctgcaga cataacacat actggtcaag cagaggaggg
    14941 agcagcatca gaagcagcag catcagcaac agcagcaaca tcagcagcag ggacagggac
    15001 gttctagtag taaacatcac aaatcctggc aggtagccac cgctggcaag gtcaccacca
    15061 aggtctagcc gtgaccccaa cagaaaacac acaccaccca cagagagtag caacacgatc
    15121 aggaggagaa gatgcaggag gaggaggaga aggatcagca gaaggaggag tagcaagtcc
    15181 tcggggactg gggacgccaa taagcaaaca tatccaaaaa ttgataaaca tatgcaaccc
    15241 cccacaggag aaaccaact