Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NG_050000 1018 bp DNA linear CON 25-MAY-2022 A beta-lactamase SHV-11, complete CDS. ACCESSION NG_050000 VERSION NG_050000.1 DBLINK BioProject: PRJNA313047 KEYWORDS RefSeq. SOURCE Klebsiella pneumoniae ORGANISM Klebsiella pneumoniae Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group; Klebsiella; Klebsiella pneumoniae complex. REFERENCE 1 AUTHORS Nuesch-Inderbinen,M.T., Kayser,F.H. and Hachler,H. TITLE Survey and molecular genetics of SHV beta-lactamases in Enterobacteriaceae in Switzerland: two novel enzymes, SHV-11 and SHV-12 JOURNAL Antimicrob. Agents Chemother. 41 (5), 943-949 (1997) PUBMED 9145849 REFERENCE 2 (bases 1 to 1018) CONSRTM NCBI Refseq Project TITLE Direct Submission JOURNAL Submitted (24-MAY-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from X98101.1. This record has been chosen as a reference for antimicrobial resistance. For more general information: http://www.ncbi.nlm.nih.gov/pathogens/ COMPLETENESS: not full length. FEATURES Location/Qualifiers source 1..1018 /organism="Klebsiella pneumoniae" /mol_type="genomic DNA" /strain="KPZU-12" /db_xref="taxon:573" /note="Plasmid" gene 74..934 /gene="blaSHV" /locus_tag="A7J11_00232" /allele="blaSHV-11" CDS 74..934 /gene="blaSHV" /locus_tag="A7J11_00232" /allele="blaSHV-11" /EC_number="3.5.2.6" /codon_start=1 /transl_table=11 /product="broad-spectrum class A beta-lactamase SHV-11" /protein_id="WP_004176269.1" /translation="MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIE MDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYS PVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDR WETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIR SVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGI GAALIEHWQR" CONTIG join(X98101.1:1..1018)