Stenotrophomonas maltophilia FE7 qacL gene for quaternary ammonium

LOCUS       NG_048051                533 bp    DNA     linear   CON 08-JUN-2016
            compound efflux SMR transporter QacL, complete CDS.
ACCESSION   NG_048051
VERSION     NG_048051.1
DBLINK      BioProject: PRJNA313047
KEYWORDS    RefSeq.
SOURCE      Stenotrophomonas maltophilia
  ORGANISM  Stenotrophomonas maltophilia
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Lysobacterales; Lysobacteraceae; Stenotrophomonas; Stenotrophomonas
            maltophilia group.
REFERENCE   1  (bases 1 to 533)
  AUTHORS   Huang,Y.-W., Chu,F.-Y., Huang,H.-H. and Yang,T.-C.
  TITLE     The contribution of class 1 integron to antimicrobials resistance
            in Stenotrophomonas maltophilia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 533)
  CONSRTM   NCBI Refseq Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from KF556708.1.
            This record has been chosen as a reference for antimicrobial
            resistance. For more general information:
            http://www.ncbi.nlm.nih.gov/pathogens/
            COMPLETENESS: not full length.
FEATURES             Location/Qualifiers
     source          1..533
                     /organism="Stenotrophomonas maltophilia"
                     /mol_type="genomic DNA"
                     /strain="FE7"
                     /isolation_source="clinical isolate"
                     /host="Homo sapiens"
                     /db_xref="taxon:40324"
                     /PCR_primers="fwd_name: int1v-f, fwd_seq:
                     ggcatccaagcagcaag, rev_name: int1v-r, rev_seq:
                     aagcagacttgacctga"
     gene            101..433
                     /gene="qacL"
                     /locus_tag="A7J11_00193"
     CDS             101..433
                     /gene="qacL"
                     /locus_tag="A7J11_00193"
                     /codon_start=1
                     /transl_table=11
                     /product="quaternary ammonium compound efflux SMR
                     transporter QacL"
                     /protein_id="WP_015059047.1"
                     /translation="MKNWLFLAIAIFGEVVATSALKSSHGFTKLVPSVVVVAGYGLAF
                     YFLSLAIKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDLWAFVGMGLIVSGVAVLN
                     LLSKVSAH"
CONTIG      join(KF556708.1:112..644)