Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NG_047883 608 bp DNA linear CON 08-JUN-2016 resistance glutathione transferase, complete CDS. ACCESSION NG_047883 VERSION NG_047883.1 DBLINK BioProject: PRJNA313047 KEYWORDS RefSeq. SOURCE Pseudomonas aeruginosa ORGANISM Pseudomonas aeruginosa Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 608) CONSRTM NCBI Refseq Project TITLE Direct Submission JOURNAL Submitted (07-JUN-2016) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from ACWU01000146.1. This record has been chosen as a reference for antimicrobial resistance. For more general information: http://www.ncbi.nlm.nih.gov/pathogens/ COMPLETENESS: not full length. FEATURES Location/Qualifiers source 1..608 /organism="Pseudomonas aeruginosa" /mol_type="genomic DNA" /strain="2_1_26" /isolation_source="gastrointestinal tract" /host="Homo sapiens" /db_xref="HMP:1030" /db_xref="taxon:287" gene 101..508 /gene="fosA" /locus_tag="A7J11_00584" CDS 101..508 /gene="fosA" /locus_tag="A7J11_00584" /EC_number="2.5.1.18" /codon_start=1 /transl_table=11 /product="FosA family fosfomycin resistance glutathione transferase" /protein_id="WP_003082280.1" /translation="MLTGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQGAYLELGS LWLCLSREPQYGGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFL DPDGHRLEAHVGDLRSRLAACRQAPYAGMRFAD" CONTIG join(ACWU01000146.1:6092..6699)