Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NG_047424 1007 bp DNA linear CON 08-JUN-2016 aminoglycoside O-phosphotransferase APH(3')-IIb, complete CDS. ACCESSION NG_047424 VERSION NG_047424.1 DBLINK BioProject: PRJNA313047 KEYWORDS RefSeq. SOURCE Pseudomonas aeruginosa PAO1-VE13 ORGANISM Pseudomonas aeruginosa PAO1-VE13 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 1007) AUTHORS Yin,Y., Withers,T.R., Niles,R.M., Johnson,S.L. and Yu,H.D. TITLE Draft Genome Sequences of Two Alginate-Overproducing Variants of Pseudomonas aeruginosa, PAO1-VE2 and PAO1-VE13 JOURNAL Genome Announc 1 (6), e01031-13 (2013) PUBMED 24336371 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1007) CONSRTM NCBI Refseq Project TITLE Direct Submission JOURNAL Submitted (07-JUN-2016) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CP006832.1. This record has been chosen as a reference for antimicrobial resistance. For more general information: http://www.ncbi.nlm.nih.gov/pathogens/ COMPLETENESS: not full length. FEATURES Location/Qualifiers source 1..1007 /organism="Pseudomonas aeruginosa PAO1-VE13" /mol_type="genomic DNA" /strain="PAO1-VE13" /db_xref="taxon:1367494" gene 101..907 /gene="aph(3')-IIb" /locus_tag="A7J11_00780" CDS 101..907 /gene="aph(3')-IIb" /locus_tag="A7J11_00780" /codon_start=1 /transl_table=11 /product="aminoglycoside O-phosphotransferase APH(3')-IIb" /protein_id="WP_003113011.1" /translation="MHDAATSMPPQAPSTWADYLAGYRWRGQGEGCSAATVHRLEAAR RPTLFVKQEVLSAHAELPAEIARLRWLHGAGIDCPQVLNETQSDGRQWLLMSAVPGDT LSALAQRGELEPERLVRLVAAALRRLHDLDPAACPFDHRLERRLDTVRQRVEAGLVDE ADFDDDHRGRSATELYRLLLDRRPAVEDLVVAHGDACLPNLLAEGRRFSGFIDCGRLG VADRHQDLALAARDIEAELGAAWAEAFLVEYGGDIDGERLAYFRLLDEFF" CONTIG join(complement(CP006832.1:4607473..4608479))