Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Pseudomonas aeruginosa PAO1-VE13 aph(3')-IIb gene for


LOCUS       NG_047424               1007 bp    DNA     linear   CON 08-JUN-2016
            aminoglycoside O-phosphotransferase APH(3')-IIb, complete CDS.
ACCESSION   NG_047424
VERSION     NG_047424.1
DBLINK      BioProject: PRJNA313047
KEYWORDS    RefSeq.
SOURCE      Pseudomonas aeruginosa PAO1-VE13
  ORGANISM  Pseudomonas aeruginosa PAO1-VE13
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Pseudomonadales; Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 1007)
  AUTHORS   Yin,Y., Withers,T.R., Niles,R.M., Johnson,S.L. and Yu,H.D.
  TITLE     Draft Genome Sequences of Two Alginate-Overproducing Variants of
            Pseudomonas aeruginosa, PAO1-VE2 and PAO1-VE13
  JOURNAL   Genome Announc 1 (6), e01031-13 (2013)
   PUBMED   24336371
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1007)
  CONSRTM   NCBI Refseq Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CP006832.1.
            This record has been chosen as a reference for antimicrobial
            resistance. For more general information:
            http://www.ncbi.nlm.nih.gov/pathogens/
            COMPLETENESS: not full length.
FEATURES             Location/Qualifiers
     source          1..1007
                     /organism="Pseudomonas aeruginosa PAO1-VE13"
                     /mol_type="genomic DNA"
                     /strain="PAO1-VE13"
                     /db_xref="taxon:1367494"
     gene            101..907
                     /gene="aph(3')-IIb"
                     /locus_tag="A7J11_00780"
     CDS             101..907
                     /gene="aph(3')-IIb"
                     /locus_tag="A7J11_00780"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside O-phosphotransferase APH(3')-IIb"
                     /protein_id="WP_003113011.1"
                     /translation="MHDAATSMPPQAPSTWADYLAGYRWRGQGEGCSAATVHRLEAAR
                     RPTLFVKQEVLSAHAELPAEIARLRWLHGAGIDCPQVLNETQSDGRQWLLMSAVPGDT
                     LSALAQRGELEPERLVRLVAAALRRLHDLDPAACPFDHRLERRLDTVRQRVEAGLVDE
                     ADFDDDHRGRSATELYRLLLDRRPAVEDLVVAHGDACLPNLLAEGRRFSGFIDCGRLG
                     VADRHQDLALAARDIEAELGAAWAEAFLVEYGGDIDGERLAYFRLLDEFF"
CONTIG      join(complement(CP006832.1:4607473..4608479))