Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_588476 putative PTS enzyme IIB component SgcB [Escherichia coli str. K-12 substr. MG1655].


>YP_588476 putative PTS enzyme IIB component SgcB [Escherichia coli str. K-12 substr. MG1655].
mkkilvacgtgmststmiahklqeflteqgisattaqcclneiplncngmdlivtsmrtnsdygiptlngaalltginddalkqqikalltq