Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_588442 PF04328 family protein YbdD [Escherichia coli str. K-12 substr. MG1655].


>YP_588442 PF04328 family protein YbdD [Escherichia coli str. K-12 substr. MG1655].
mfdslakagkylgqaaklmigmpdydnyvehmrvnhpdqtpmtyeeffrerqdaryggkggarcc