Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_026270 twin arginine protein translocation system - TatB protein [Escherichia coli str. K-12 substr. MG1655].


>YP_026270 twin arginine protein translocation system - TatB protein [Escherichia coli str. K-12 substr. MG1655].
mfdigfselllvfiiglvvlgpqrlpvavktvagwiralrslattvqneltqelklqefqdslkkvekasltnltpelkasmdelrqaaesmkrsyvand
pekasdeahtihnpvvkdneaahegvtpaaaqtqasspeqkpettpepvvkpaadaepktaapspsssdkp