Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_010051186 putative zinc-binding protein YnfU [Escherichia coli str. K-12 substr. MG1655].


>YP_010051186 putative zinc-binding protein YnfU [Escherichia coli str. K-12 substr. MG1655].
mserknsksrrnylvkcscpnctqesehsfsrvqkgallicphcnkvfqtnlkava