Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_009518746 putative LysR family substrate binding domain-containing protein YagP [Escherichia coli str. K-12 substr. MG1655].


>YP_009518746 putative LysR family substrate binding domain-containing protein YagP [Escherichia coli str. K-12 substr. MG1655].
mpapvvlilaagrgecflasggnthkcigwrqspevapyrwpfeengrtfdlaiepqittndlrlmlrlalagggitiatqetfrpyiesgklvsllddf
lpqfpgfylyfpqrrniapklralidyvkewrqqla