Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_009502675 toxic peptide regulated by antisense sRNA symR [Escherichia coli O157:H7 str. Sakai].


>YP_009502675 toxic peptide regulated by antisense sRNA symR [Escherichia coli O157:H7 str. Sakai].
mtdthsiaqpfeaevspannrqltvsyasrypdysripaitlkgqwleaagfatgtvvdvkvmegcivltaqppaaaeselmqslrqvcklsarkqrqvq
efigviagkqkva