Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_008439270 Insertion element iso-IS1N protein insA [Shigella flexneri 2a str. 301].


>YP_008439270 Insertion element iso-IS1N protein insA [Shigella flexneri 2a str. 301].
mtsvnihcprcqsaqvyrhgqnpkgrdrlrcrdchrvfqftytyqarkpgmkelitemafngagvrdtartlkigsntvirtlknsrqse